Hamburger Menu Button
Thermo Fisher Scientific Logo
登入
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Tubes
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO 和 CRO 服務
    • CDMO 服務
    • 臨床試驗 CRO 服務
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • Register for an Account
    • How to Order
    • Instrument Support
    • Technical Support Centers
    • Learning Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • 快速訂購
          • 登入
            登入
            Don't have an account ? Create Account
            • 帳戶
            • 訂單
            • 訂製產品與專案

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • Calcitonin Antibodies

          Invitrogen

          Calcitonin Polyclonal Antibody

          View all (27) Calcitonin antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Protocols
          Questions & Answers
          Tech Support

          Cite Calcitonin Polyclonal Antibody

          • Antibody Testing Data (2)
          Calcitonin Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          Calcitonin Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 2

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          Calcitonin Antibody (PA5-95529) in IHC (P)

          Immunohistochemistry analysis of Calcitonin in paraffin-embedded mouse brain tissue. Antigen retrieval was performed on the tissue using citrate buffer (pH 6, 20 min) and blocked with 10% goat serum. Samples were incubated with Calcitonin polyclonal antibody (Product # PA5-95529) at a 2 µg/mL dilution, followed by biotinylated goat anti-rabbit IgG (30 min, 37°C), and developed with Strepavidin-Biotin-Comple... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          Calcitonin Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Calcitonin Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Calcitonin Polyclonal Antibody

          Product Details

          PA5-95529

          Applications
          Tested Dilution
          Publications

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence of mouse Calcitonin (CGNLSTCMLGTYTQDLNKFHTFPQTSIGVEAP) (aa 85-116).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807331

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - IHC: mouse brain tissue, rat brain tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          Calcitonin is a 32 amino acid peptide which can be demonstrated in C cells of the normal and hyperplastic thyroid. Staining for calcitonin may be used for the identification of a spectrum of C cell proliferative abnormalities ranging from C cell hyperplasia to invasive tumors. Staining for calcitonin in medullary carcinoma of the thyroid produces a fine granular pattern in the cytoplasm. Amyloid deposits within the tumor may also exhibit varying degrees of calcitonin activity.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: Alpha CGRP; Alpha type CGRP; Alpha-type CGRP; Calcitonin; calcitonin 1; calcitonin gene related peptide 1; Calcitonin gene-related peptide 1; Calcitonin gene-related peptide I; calcitonin-related polypeptide alpha; calcitonin/calcitonin-related polypeptide, alpha; CGRP-I; CGRP1; katacalcin; katacalcin (KC)

          View more View less

          Gene Aliases: CA; Cal1; CAL6; Calc; CALC1; CALCA; calcitonin; CGRP; CGRP-1; CGRP-I; CGRP1; CT; Ctn; KC; PCT; RATCAL6

          View more View less

          UniProt ID: (Human) P01258, (Rat) P01257, (Mouse) P70160

          View more View less

          Entrez Gene ID: (Human) 796, (Rat) 24241, (Mouse) 12310

          View more View less

          Function(s)
          hormone activity protein binding calcitonin receptor binding identical protein binding receptor binding neuropeptide hormone activity protein complex binding peptide hormone
          Process(es)
          vasodilation of artery involved in baroreceptor response to increased systemic arterial blood pressure regulation of heart rate monocyte chemotaxis inflammatory response adenylate cyclase-activating G-protein coupled receptor signaling pathway activation of adenylate cyclase activity positive regulation of cytosolic calcium ion concentration neuropeptide signaling pathway embryo implantation aging feeding behavior response to heat negative regulation of ossification negative regulation of neurological system process activation of protein kinase activity cellular protein metabolic process positive regulation of adenylate cyclase activity positive regulation of ossification negative regulation of bone resorption negative regulation of transcription, DNA-templated negative regulation of smooth muscle contraction response to pain detection of temperature stimulus involved in sensory perception of pain positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway cellular response to tumor necrosis factor cellular response to nerve growth factor stimulus endothelial cell proliferation vasculature development neurological system process involved in regulation of systemic arterial blood pressure G-protein coupled receptor internalization protein phosphorylation cellular calcium ion homeostasis leukocyte cell-cell adhesion neuromuscular junction development regulation of heart contraction regulation of blood pressure negative regulation of calcium ion transport into cytosol positive regulation of cAMP biosynthetic process receptor internalization positive regulation of interleukin-1 alpha production positive regulation of interleukin-8 production vasodilation endothelial cell migration positive regulation of macrophage differentiation negative regulation of osteoclast differentiation negative regulation of blood pressure positive regulation of cell adhesion positive regulation of vasodilation regulation of cytosolic calcium ion concentration sperm capacitation mitophagy in response to mitochondrial depolarization
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-green-55658555d6-pnd5g:80/100.66.79.83:80.
          git-commit: ec8e7df5f8fec8d765bd419205f1b5046a016d37
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.41.0-Offline