Invitrogen

DDAH1 Polyclonal Antibody

Tech Support

Datasheet

Protocols

Questions & Answers

Tech Support

Product Image Gallery

DDAH1 Antibody in Immunohistochemistry (Paraffin) (IHC (P)) — Immunohistochemistry analysis of DDAH1 in paraffin-embedded mouse brain tissues. Antigen retrieval was performed on the tissue using citrate buffer (pH 6, 20 min) and blocked with 10% goat serum. Samples were incubated with DDAH1 polyclonal antibody (Product # PA5-95366) at a 1 µg/mL dilution, followed by biotinylated goat anti-rabbit IgG (30 min, 37°C), and developed with Strepavidin-Biotin-Complex and DAB.

DDAH1 Antibody in Western Blot (WB) — Western blot analysis of DDAH1 in Lane 1: rat kidney tissue lysates, Lane 2: mouse kidney tissue lysates, Lane 3: HeLa whole cell lysates. Electrophoresis was performed with 5-20% SDS-PAGE gel (70V, Stacking gel; 90V Resolving gel, Time: 2-3 hours), transferred to a nitrocellulose membrane and blocked using 5% Non-fat Milk/TBS (1.5 hrs at room temperature). Samples were incubated with DDAH1 polyclonal antibody (Product # PA5-95366) using a 0.5 µg/mL dilution, followed by a goat anti-rabbit IgG-HRP at a dilution of 1:10,000, and developed with enhanced chemiluminescence (ECL).

Product Details

PA5-95366

Applications	Tested Dilution	Publications
Western Blot (WB)	0.1-0.5 µg/mL	View 1 publication 1 publication
Immunohistochemistry (Paraffin) (IHC (P))	0.5-1 µg/mL	-

Product Specifications
Species Reactivity	Human, Mouse, Rat
Published species	Mouse
Host/Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human DDAH1, different from the related mouse and rat sequences by one amino acid. View immunogen
Conjugate	Unconjugated
Form	Lyophilized
Concentration	500 µg/mL
Purification	Affinity chromatography
Storage buffer	PBS with 5mg BSA
Contains	0.05mg sodium azide
Storage conditions	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
RRID	AB_2807169

Product Specific Information

Synthetic peptide sequence: 195-226aa, QKALKIMQQMSDHRYDKLTVPDDIAANCIYLN.

Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.

Target Information

This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Product References

Upregulation of DDAH2 Limits Pulmonary Hypertension and Right Ventricular Hypertrophy During Chronic Hypoxia in Ddah1 Knockout Mice.

Frontiers in physiology

Hannemann J,Glatzel A,Hillig J,Zummack J,Schumacher U,Lüneburg N,Harbaum L,Böger R

PA5-95366 was used in Western Blotting to investigate the role of Ddah1 in the development of hypoxia-associated pulmonary hypertension.

Tue Dec 08 00:00:00 EST 2020

Upregulation of DDAH2 Limits Pulmonary Hypertension and Right Ventricular Hypertrophy During Chronic Hypoxia in Ddah1 Knockout Mice.

Frontiers in physiology

Hannemann J,Glatzel A,Hillig J,Zummack J,Schumacher U,Lüneburg N,Harbaum L,Böger R

PA5-95366 was used in Western Blotting to investigate the role of Ddah1 in the development of hypoxia-associated pulmonary hypertension.

Tue Dec 08 00:00:00 EST 2020

Bioinformatics

Protein Aliases: DDAH-1; DDAHI; Dimethylargininase-1; epididymis secretory protein Li 16; FLJ21264; FLJ25539; N(G),N(G)-dimethylarginine dimethylaminohydrolase 1; NG, NG-dimethylarginine dimethylaminohydrolase; NG,NG dimethylarginine dimethylaminohydrolase; RP4-621F18.1

Gene Aliases: 2410006N07Rik; 2510015N06Rik; AI987801; AW050362; DDAH; DDAH1; HEL-S-16

UniProt ID: (Human) O94760, (Mouse) Q9CWS0, (Rat) O08557

Entrez Gene ID: (Human) 23576, (Mouse) 69219, (Rat) 64157

Molecular Function: hydrolase