Invitrogen

DDAH1 Polyclonal Antibody

Product Image Gallery

DDAH1 Antibody in Immunohistochemistry (Paraffin) (IHC (P)) — Immunohistochemistry analysis of DDAH1 in paraffin-embedded mouse brain tissues. Antigen retrieval was performed on the tissue using citrate buffer (pH 6, 20 min) and blocked with 10% goat serum. Samples were incubated with DDAH1 polyclonal antibody (Product # PA5-95366) at a 1 µg/mL dilution, followed by biotinylated goat anti-rabbit IgG (30 min, 37°C), and developed with Strepavidin-Biotin-Complex and DAB.

DDAH1 Antibody in Western Blot (WB) — Western blot analysis of DDAH1 in Lane 1: rat kidney tissue lysates, Lane 2: mouse kidney tissue lysates, Lane 3: HeLa whole cell lysates. Electrophoresis was performed with 5-20% SDS-PAGE gel (70V, Stacking gel; 90V Resolving gel, Time: 2-3 hours), transferred to a nitrocellulose membrane and blocked using 5% Non-fat Milk/TBS (1.5 hrs at room temperature). Samples were incubated with DDAH1 polyclonal antibody (Product # PA5-95366) using a 0.5 µg/mL dilution, followed by a goat anti-rabbit IgG-HRP at a dilution of 1:10,000, and developed with enhanced chemiluminescence (ECL).

Product Details

Applications

Tested Dilution

Publications

Immunohistochemistry (Paraffin) (IHC (P))

0.5-1 µg/mL

Western Blot (WB)

0.1-0.5 µg/mL

Product Specifications

Species Reactivity

Human, Mouse, Rat

Host / Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human DDAH1, different from the related mouse and rat sequences by one amino acid.

Conjugate

Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Purification

Affinity chromatography

Storage buffer

0.2mg sodium phosphate with 5mg BSA, 0.9mg NaCl

Contains

0.05mg sodium azide

Storage conditions

Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.

RRID

AB_2807169

Product Specific Information

Synthetic peptide sequence: 195-226aa, QKALKIMQQMSDHRYDKLTVPDDIAANCIYLN.

Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.

Target Information

RANK is a member of the tumor necrosis factor receptor (TNFR) family. The full length mouse RANK cDNA encodes a type I transmembrane protein with an extracellular and a cytoplasmic domain. The extracellular domain contains two potential N-linked glycosylation sites. RANK shares significant amino acid homology with other members of the TNFR family in its extracellular four cysteine-rich repeats. Human and murine RANK share 81% amino acid identity in their extracellular domains.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?

Let us know so we can reference it here.

Cite this antibody

Bioinformatics

Protein Aliases: 3.5.3.18; DDAH; DDAH-1; DDAH1; DDAHI; Dimethylargininase-1; Dimethylarginine dimethylaminohydrolase 1; epididymis secretory protein Li 16; N(G),N(G)-dimethylarginine dimethylaminohydrolase 1; NG, NG-dimethylarginine dimethylaminohydrolase; NG,NG dimethylarginine dimethylaminohydrolase

Gene Aliases: 2410006N07Rik; 2510015N06Rik; AI987801; AW050362; DDAH; DDAH1; HEL-S-16

UniProt ID: (Human) O94760, (Mouse) Q9CWS0, (Rat) O08557

Entrez Gene ID: (Human) 23576, (Mouse) 69219, (Rat) 64157

Molecular Function: hydrolase