Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | View 1 publication 1 publication |
Immunohistochemistry (Paraffin) (IHC (P)) |
0.5-1 µg/mL | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Published species |
Mouse |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence at the C-terminus of human DDAH1, different from the related mouse and rat sequences by one amino acid. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Affinity chromatography |
Storage buffer |
PBS with 5mg BSA |
Contains |
0.05mg sodium azide |
Storage conditions |
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
RRID |
AB_2807169 |
Synthetic peptide sequence: 195-226aa, QKALKIMQQMSDHRYDKLTVPDDIAANCIYLN.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: DDAH-1; DDAHI; Dimethylargininase-1; epididymis secretory protein Li 16; FLJ21264; FLJ25539; N(G),N(G)-dimethylarginine dimethylaminohydrolase 1; NG, NG-dimethylarginine dimethylaminohydrolase; NG,NG dimethylarginine dimethylaminohydrolase; RP4-621F18.1
Gene Aliases: 2410006N07Rik; 2510015N06Rik; AI987801; AW050362; DDAH; DDAH1; HEL-S-16
UniProt ID: (Human) O94760, (Mouse) Q9CWS0, (Rat) O08557
Entrez Gene ID: (Human) 23576, (Mouse) 69219, (Rat) 64157
Molecular Function:
hydrolase
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support