Invitrogen

DVL1 Polyclonal Antibody

Product Image Gallery

DVL1 Antibody in Immunohistochemistry (Paraffin) (IHC (P)) — Immunohistochemistry analysis of DVL1 on paraffin-embedded human lung cancer tissue. Antigen retrieval was performed using citrate buffer (pH6, epitope retrieval solution) for 20 mins. Sample was blocked using 10% goat serum, incubated with DVL1 polyclonal antibody (Product# PA5-79176) with a dilution of 1 µg/mL (overnight at 4°C), and followed by biotinylated goat anti-rabbit IgG (30 minutes at 37°C). Development was performed using Streptavidin-Biotin-Complex (SABC) with DAB chromogen method.

DVL1 Antibody in Western Blot (WB) — Western blot analysis of DVL1 in Lane 1: rat brain tissue lysate, Lane 2: rat testis tissue lysate using 50 µg (reducing conditions) per well. Electrophoresis was performed on 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours and protein was transferred to a nitrocellulose membrane at 150mA for 50-90 minutes. Sample was blocked with 5% Non-fat Milk/TBS for 1.5 hours at room temperature, incubated with DVL1 polyclonal antibody (Product # PA5-79176) at a dilution of 0.5 µg/mL (overnight at 4°C), followed by goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10,000. Signal development was performed using a chemiluminescence (ECL) kit.

Product Details

Tested Applications

Dilution

Immunohistochemistry (Paraffin) (IHC (P))

0.5-1 µg/mL

Western Blot (WB)

0.1-0.5 µg/mL

Product Specifications

Species Reactivity

Human, Rat

Host / Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human DVL1.

Conjugate

Unconjugated

Form

Lyophilized

Purification

Antigen affinity chromatography

Storage buffer

PBS with 4mg trehalose

Contains

0.05mg sodium azide

Storage conditions

-20°C

RRID

AB_2746292

Product Specific Information

The synthetic peptide sequence is 401-438aa, APQLEEAPLTVKSDMSAVVRVMQLPDSGLEIRDRMWLK

Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.

Target Information

DVL1, the human homolog of the Drosophila dishevelled gene (dsh) encodes a cytoplasmic phosphoprotein that regulates cellproliferation, acting as a transducer molecule for developmentalprocesses, including segmentation and neuroblast specification.DVL1 is a candidate gene for neuroblastomatous transformation. TheSchwartz-Jampel syndrome and Charcot-Marie-Tooth disease type 2Ahave been mapped to the same region as DVL1. The phenotypes ofthese diseases may be consistent with defects which might beexpected from aberrant expression of a DVL gene during development.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Bioinformatics

Protein Aliases: dishevelled 1; dishevelled 1 (homologous to Drosophila dsh); dishevelled, dsh homolog 1; Dishevelled-1; DSH homolog 1; DVL1; Segment polarity protein dishevelled homolog DVL-1

Gene Aliases: DRS2; DVL; dvl-1; DVL1; DVL1L1; DVL1P1

UniProt ID: (Human) O14640, (Rat) Q9WVB9

Entrez Gene ID: (Human) 1855, (Rat) 83721

Molecular Function: enzyme modulator signaling molecule