Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Immunohistochemistry (Paraffin) (IHC (P)) |
0.5-1 µg/mL | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence in the middle region of human DVL1. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Antigen affinity chromatography |
Storage buffer |
PBS with 4mg trehalose |
Contains |
0.05mg sodium azide |
Storage conditions |
-20°C |
RRID |
AB_2746292 |
The synthetic peptide sequence is 401-438aa, APQLEEAPLTVKSDMSAVVRVMQLPDSGLEIRDRMWLK
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
DVL1, the human homolog of the Drosophila dishevelled gene (dsh) encodes a cytoplasmic phosphoprotein that regulates cellproliferation, acting as a transducer molecule for developmentalprocesses, including segmentation and neuroblast specification.DVL1 is a candidate gene for neuroblastomatous transformation. TheSchwartz-Jampel syndrome and Charcot-Marie-Tooth disease type 2Ahave been mapped to the same region as DVL1. The phenotypes ofthese diseases may be consistent with defects which might beexpected from aberrant expression of a DVL gene during development.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: dishevelled 1; dishevelled 1 (homologous to Drosophila dsh); dishevelled, dsh homolog 1; Dishevelled-1; Dishevelled-1-like; DSH homolog 1; DSH homolog 1-like; MGC54245; RP5-890O3.5; Segment polarity protein dishevelled homolog DVL-1
Gene Aliases: DRS2; DVL; dvl-1; DVL1; DVL1L1; DVL1P1
UniProt ID: (Human) O14640, (Rat) Q9WVB9
Entrez Gene ID: (Human) 1855, (Rat) 83721
Molecular Function:
scaffold/adaptor protein
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support