Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Product Details
PA5-109672
| Applications | Tested Dilution | Publications |
|---|---|---|
Western Blot (WB) |
1:500-1:2,000 | - |
Immunohistochemistry (Paraffin) (IHC (P)) |
1:50-1:100 | - |
Immunocytochemistry (ICC/IF) |
1:50-1:100 | - |
| Product Specifications | |
|---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 670-770 of human ECE1 (NP_001388.1). |
Conjugate |
Unconjugated |
Form |
Liquid |
Concentration |
0.62 mg/mL |
Purification |
Affinity Chromatography |
Storage buffer |
PBS, pH 7.3, with 50% glycerol |
Contains |
0.01% thimerosal |
Storage conditions |
-20° C, Avoid Freeze/Thaw Cycles |
RRID |
AB_2855083 |
Product Specific Information
Sequence of this protein is as follows: ADNGGLKAAYRAYQNWVKKNGAEHSLPTLGLTNNQLFFLGFAQVWCSVRTPESSHEGLITDPHSPSRFRVIGSLSNSKEFSEHFRCPPGSPMNPPHKCEVW
Target Information
ECE-1 is involved in proteolytic processing of endothelin precursors to biologically active peptides.
⚠WARNING: This product can expose you to chemicals including mercury, which is known to the State of California to cause birth defects or other reproductive harm. For more information go to www.P65Warnings.ca.gov.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: ECE 1; ECE-1; Endothelin-converting enzyme 1; endothelin-converting enzyme-1a; endothelin-converting enzyme-1b; endothelin-converting enzyme-1d
Gene Aliases: AW322500; ECE; ECE-1; ECE-1a; ECE-1b; ECE-1d; ECE1
UniProt ID: (Human) P42892, (Mouse) Q4PZA2
Entrez Gene ID: (Human) 1889, (Rat) 94204, (Mouse) 230857
Molecular Function:
metalloprotease
response to hypoxia
positive regulation of receptor recycling
regulation of systemic arterial blood pressure by endothelin
apoptotic process
heart development
positive regulation of cardiac muscle hypertrophy
substance P catabolic process
bradykinin catabolic process
calcitonin catabolic process
protein processing
peptide hormone processing
regulation of vasoconstriction
positive regulation of cAMP biosynthetic process
endothelin maturation
response to muscle stretch
regulation of vasodilation
hormone catabolic process
response to drug
embryonic digit morphogenesis
ear development
positive regulation of G-protein coupled receptor protein signaling pathway
response to cadmium ion
pharyngeal system development
regulation of ERK1 and ERK2 cascade
proteolysis
regulation of blood pressure
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support