Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
1:500-1:2,000 | - |
Immunohistochemistry (Paraffin) (IHC (P)) |
1:50-1:100 | - |
Immunocytochemistry (ICC/IF) |
1:50-1:100 | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 670-770 of human ECE1 (NP_001388.1). |
Conjugate |
Unconjugated |
Form |
Liquid |
Concentration |
2.95 mg/mL |
Purification |
Antigen affinity chromatography |
Storage buffer |
PBS, pH 7.3, with 50% glycerol |
Contains |
0.02% sodium azide |
Storage conditions |
-20° C, Avoid Freeze/Thaw Cycles |
RRID |
AB_2855083 |
Sequence of this protein is as follows: ADNGGLKAAYRAYQNWVKKNGAEHSLPTLGLTNNQLFFLGFAQVWCSVRTPESSHEGLITDPHSPSRFRVIGSLSNSKEFSEHFRCPPGSPMNPPHKCEVW
ECE-1 is involved in proteolytic processing of endothelin precursors to biologically active peptides.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: ECE 1; ECE-1; Endothelin-converting enzyme 1; endothelin-converting enzyme-1a; endothelin-converting enzyme-1b; endothelin-converting enzyme-1d
Gene Aliases: AW322500; ECE; ECE-1; ECE-1a; ECE-1b; ECE-1d; ECE1
UniProt ID: (Human) P42892, (Mouse) Q4PZA2
Entrez Gene ID: (Human) 1889, (Rat) 94204, (Mouse) 230857
Molecular Function:
metalloprotease
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support