Search
Invitrogen
EEF2 Monoclonal Antibody (5F5)
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 12
EEF2 Antibody (MA5-49171) in ICC/IF
Immunocytochemistry analysis of EEF2 in HEPG2 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum. Samples were then incubated in EEF2 Monoclonal antibody (Product # MA5-49171) using a dilution of 5 μg/mL. DyLight®488 Conjugated Goat Anti-Mouse IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for ... View More
Product Details
MA5-49171
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Mouse
/ IgG1
Class
Monoclonal
Type
Antibody
Clone
5F5
Immunogen
A synthetic peptide corresponding to a sequence of human EEF2 (QTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
no preservative
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Adding 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
Positive Control - WB: human Hela whole cell, human HEPG2 whole cell, human Jurkat whole cell, human U20S whole cell, rat PC-12 whole cell, mouse NIH/3T3 whole cell. IHC: human breast cancer tissue, human rectal cancer tissue, human liver cancer tissue, human rectal cancer tissue. ICC/IF: HEPG2 cell. Flow: HEPA1-6 cell, HL-60 cell, NRK cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: EF-2; Elongation factor 2; elongation factor-2; epididymis secretory sperm binding protein; polypeptidyl-tRNA translocase; unnamed protein product
Gene Aliases: EEF-2; EEF2; EF-2; EF2; SCA26
UniProt ID: (Human) P13639, (Mouse) P58252, (Rat) P05197
Entrez Gene ID: (Human) 1938, (Mouse) 13629, (Rat) 29565
nucleotide binding
p53 binding
RNA binding
translation elongation factor activity
GTPase activity
protein binding
GTP binding
5S rRNA binding
hydrolase activity
protein kinase binding
ribosome binding
cadherin binding
actin filament binding
lncRNA binding
poly(A) RNA binding
translation activator activity
translation elongation factor
hematopoietic progenitor cell differentiation
response to ischemia
skeletal muscle contraction
translation
translational elongation
response to xenobiotic stimulus
glial cell proliferation
response to estradiol
response to endoplasmic reticulum stress
skeletal muscle cell differentiation
response to hydrogen peroxide
response to ethanol
positive regulation of translation
response to folic acid
translation at postsynapse
cellular response to brain-derived neurotrophic factor stimulus
positive regulation of cytoplasmic translation
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support