Search Thermo Fisher Scientific
Search Thermo Fisher Scientific
Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Flow Cytometry (Flow) |
1-3 µg/1x10^6 cells | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence at the C-terminus of human EPHX2 (505-543aa QHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLD). |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Affinity chromatography |
Storage buffer |
PBS with 5mg BSA |
Contains |
0.05mg sodium azide |
Storage conditions |
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
RRID |
AB_2807198 |
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
This gene encodes a member of the epoxide hydrolase family. The protein, found in both the cytosol and peroxisomes, binds to specific epoxides and converts them to the corresponding dihydrodiols. Mutations in this gene have been associated with familial hypercholesterolemia. Alternatively spliced transcript variants have been described.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: Bifunctional epoxide hydrolase 2; CEH; cytosolic epoxide hydrolase; Cytosolic epoxide hydrolase 2; Epoxide hydratase; epoxide hydrolase 2, cytoplasmic; epoxide hydrolase 2, cytosolic; epoxide hydrolase 2C; epoxide hydrolase, soluble; Lipid-phosphate phosphatase; SEH; Soluble epoxide hydrolase
Gene Aliases: CEH; Eph2; EPHX2; SEH; sEP
UniProt ID: (Human) P34913, (Mouse) P34914, (Rat) P80299
Entrez Gene ID: (Human) 2053, (Mouse) 13850, (Rat) 65030
Molecular Function:
hydrolase
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support