Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
FABP5 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 2
FABP5 Antibody (PA5-79232) in ICC/IF
Immunocytochemistry/Immunofluorescence analysis of FABP5 in A549 cells using FABP5 Polyclonal Antibody (Product # PA5-79232). Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and incubated with the primary antibody at 5 µg/mL. DyLight 488 conjugated goat anti-rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter set... View More
Product Details
PA5-79232
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of mouse FABP5 (KWRLMESHGFEEYMKELGVGLALRKMAAMAKPD).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
no preservative
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human RT4 whole cell, human PC-3 whole cell, rat lung tissue, mouse lung tissue. ICC/IF: A549 cell.
Target Information
FABP5 (fatty acid binding protein 5 (psoriasis-associated)) is a proteinthat in humans is encoded by theFABP5 gene, also known as PAFABP, EFABP, E-FABP, KFABP, PA-FABP, Epidermal-type fatty acid-binding protein, Fatty acid-binding protein 5, Psoriasis-associated fatty acid-binding protein homolog. It is a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. The PAFABP cDNA encodes a 135-amino acid protein with molecular weight 15,164. This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated inpsoriasistissue. It is though that FABPs roles include fatty acid uptake, transport, and metabolism. Kaczocha et al. (2009) identifiedFABP5and FABP7 as cytosolic proteins that transport AEA from the plasma membrane to subcellular fatty acid amide hydrolase, where it is hydrolyzed and inactivated. FABP3 did not show this specific transport function.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: C-FABP; Cutaneous fatty acid-binding protein; DA11; E-FABP; E-FABPPAFABP; Epidermal-type fatty acid-binding protein; epithelial fatty acid-binding protein; fatty acid binding protein 5 (psoriasis-associated); Fatty acid-binding protein 5; Fatty acid-binding protein, epidermal; Keratinocyte lipid-binding protein; PA-FABP; PA-FABPepidermal; Psoriasis-associated fatty acid-binding protein homolog
Gene Aliases: C-FABP; DA11; E-FABP; EFABP; FABP5; Fabpe; KFABP; Klbp; Mal1; PA-FABP; PAFABP
UniProt ID: (Human) Q01469, (Rat) P55053, (Mouse) Q05816
Entrez Gene ID: (Human) 2171, (Rat) 140868, (Mouse) 16592
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support