Search
Invitrogen
FMO1 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 3
FMO1 Antibody (PA5-95285) in WB
Western blot analysis of FMO1 using FMO1 Polyclonal Antibody (Product # PA5-95285). Electrophoresis was performed on a 10% SDS-PAGE gel at 80V (Stacking gel)/120V (Resolving gel) for 2 hours. The sample well of each lane was loaded with 30 µg of sample under reducing conditions. Lane 1: human hepatocellular carcinoma tumor tissue (HCCT) lysates. Lane 2: human HepG2 whole cell lysates. Lane 3: human HUH7 whole cell lysates. Lane 4: rat liver tissue lysates. Lane 5: mouse liver tissue lysates. After electrophoresis, proteins were transferred... View More
Product Details
PA5-95285
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Published species
Mouse
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human FMO1 (334-363aa AFPFLDESVVKVEDGQASLYKYIFPAHLQK).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Affinity chromatography
Storage buffer
4mg trehalose, 0.9mg NaCl, 0.2mg Na2PO4
Contains
no preservative
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human hepatocellular carcinoma tumor tissue, human HepG2 whole cell, human HUH7 whole cell, rat liver tissue, mouse liver tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Bioinformatics
Protein Aliases: Dimethylaniline monooxygenase [N-oxide-forming] 1; Dimethylaniline oxidase 1; Fetal hepatic flavin-containing monooxygenase 1; flavin containing monooxygenase 1; Flavin-containing monooxygenase 1; Flavin-containing monooxygenase 1 (fetal liver); FMO 1; Hepatic flavin-containing monooxygenase 1; Trimethylamine monooxygenase; unnamed protein product
Gene Aliases: Fmo-1; FMO1; RFMO1A
UniProt ID: (Human) Q01740, (Rat) P36365, (Mouse) P50285
Entrez Gene ID: (Human) 2326, (Rat) 25256, (Mouse) 14261
sulfur amino acid catabolic process
organic acid metabolic process
xenobiotic metabolic process
toxin metabolic process
response to lipopolysaccharide
taurine biosynthetic process
negative regulation of fatty acid oxidation
energy homeostasis
response to osmotic stress
drug metabolic process
oxidation-reduction process
NADPH oxidation
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support