Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Promotions
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Promos
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central
          • Primary Antibodies ›
          • FMRP Antibodies

          Invitrogen

          FMRP Polyclonal Antibody

          Greener Choice
          View all (39) FMRP antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers

          Cite FMRP Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (3)
          FMRP Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          FMRP Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 3

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          FMRP Antibody (PA5-79278) in ICC/IF

          Immunocytochemistry analysis of FMRP/FMR1 using anti-FMRP/FMR1 antibody (Product # PA5-79278) . FMRP/FMR1 was detected in an immunocytochemical section of HeLa cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 5 μg/mL rabbit anti-FMRP/FMR1 antibody (Product # PA5-79278) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The se... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          FMRP Antibody in Immunocytochemistry (ICC/IF)
          FMRP Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          FMRP Antibody in Western Blot (WB)
          FMRP Polyclonal Antibody

          Product Details

          PA5-79278

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          2-5 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of human FMRP (164-200aa ENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIM).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746394

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human Hela whole cell, human 293T whole cell, human Jurkat whole cell, human K562 whole cell, rat brain tissue, rat liver tissue, mouse brain tissue, mouse liver tissue. IHC: human seminoma testis tissue. ICC/IF: Hela cell.

          Target Information

          FMR1 binds RNA and is associated with polysomes. The protein may be involved in mRNA trafficking from the nucleus to the cytoplasm. A trinucleotide repeat in the 5' UTR is normally found at 6-53 copies, but an expansion to 55-230 repeats is the cause of fragile X syndrome. Expansion of the trinucleotide repeat may also cause one form of premature ovarian failure. Multiple alternatively spliced transcript variants that encode different protein isoforms and which are located in different cellular locations have been described for this gene.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: FMRP; FMRP translational regulator 1; fragile X mental retardation protein 1 homolog; fragile X mental retardation syndrome 1 homolog; fragile X mental retardation-1 protein; Fragile X messenger ribonucleoprotein; Fragile X messenger ribonucleoprotein 1; mFmr1p; MGC87458; Protein FMR-1; ragile X mental retardation protein; synaptic functional regulator FMR1; unnamed protein product

          View more View less

          Gene Aliases: Fmr-1; FMR1; FMRP; FRAXA; POF; POF1

          View more View less

          UniProt ID: (Human) Q06787, (Rat) Q80WE1, (Mouse) P35922

          View more View less

          Entrez Gene ID: (Human) 2332, (Rat) 24948, (Mouse) 14265

          View more View less

          Function(s)
          G-quadruplex RNA binding nucleic acid binding chromatin binding RNA binding mRNA binding mRNA 3'-UTR binding protein binding microtubule binding poly(U) RNA binding translation repressor activity translation initiation factor binding RNA strand annealing activity poly(G) binding siRNA binding miRNA binding signaling adaptor activity RNA stem-loop binding identical protein binding protein homodimerization activity ribosome binding ion channel binding macromolecular complex binding translation regulator activity protein heterodimerization activity mRNA 5'-UTR binding dynein complex binding histone H3 reader activity molecular condensate scaffold activity N6-methyladenosine-containing RNA binding sequence-specific mRNA binding poly(A) RNA binding translation factor
          Process(es)
          deadenylation-dependent decapping of nuclear-transcribed mRNA regulation of alternative mRNA splicing, via spliceosome positive regulation of receptor internalization DNA repair chromatin organization mRNA processing mRNA export from nucleus regulation of translation cellular response to DNA damage stimulus glutamate receptor signaling pathway nervous system development RNA splicing regulation of cell communication negative regulation of translation gene silencing by RNA stress granule assembly regulation of mRNA stability modulation by host of viral RNA genome replication positive regulation of translation negative regulation of translational initiation regulation of neurotransmitter secretion positive regulation of long-term neuronal synaptic plasticity animal organ development mRNA transport positive regulation of cellular component organization regulation of filopodium assembly positive regulation of filopodium assembly negative regulation of gene silencing by miRNA regulation of dendritic spine development positive regulation of dendritic spine development regulation of biological quality cellular response to virus regulation of neuronal action potential regulation of translation at presynapse, modulating synaptic transmission membraneless organelle assembly negative regulation of long term synaptic depression positive regulation of intracellular transport of viral material negative regulation of voltage-gated calcium channel activity positive regulation of proteasomal protein catabolic process negative regulation of synaptic vesicle exocytosis positive regulation of gene silencing by miRNA negative regulation of cytoplasmic translation central nervous system development transport dendritic spine development
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy Consumer Health Data Privacy Policy
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Notice
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-pgj68:80/100.66.79.163:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline