Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Product Details
PA5-79287
| Applications | Tested Dilution | Publications |
|---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Immunohistochemistry (Paraffin) (IHC (P)) |
0.5-1 µg/mL | - |
| Product Specifications | |
|---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence at the N-terminus of human FUT1 (134-164aa EVDSRTPWRELQLHDWMSEEYADLRDPFLKL). |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Antigen affinity chromatography |
Storage buffer |
PBS with 4mg trehalose |
Contains |
0.05mg sodium azide |
Storage conditions |
-20°C |
RRID |
AB_2746403 |
Product Specific Information
Reconstitute with 0.2 ml of distilled water to yield a concentration of 500 µg/ml.
Target Information
FUT1 is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: 2-alpha-L-fucosyltransferase; alpha (1,2) fucosyltransferase; Alpha 1,2-fucosyltransferase A; alpha 12-fucosyltransferase; alpha(1,2) fucosyltransferase 1; Alpha(1,2)FT 1; alpha12-fucosyltransferase a; beta-galactoside alpha-1,2-fucosyltransferase; Blood group H alpha 2-fucosyltransferase; Fucosyltransferase 1; fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase); fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group); galactoside 2-alpha-L-fucosyltransferase 1; Galactoside alpha-(1,2)-fucosyltransferase 1; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1; H transferase; MFUT-1; Type 1 galactoside alpha-(1,2)-fucosyltransferase FUT1; Type 2 galactoside alpha-(1,2)-fucosyltransferase FUT1
Gene Aliases: Fta; FUT1; Futa; H; HH; HSC
UniProt ID: (Human) P19526, (Rat) Q10980, (Mouse) O09160
Entrez Gene ID: (Human) 2523, (Rat) 81919, (Mouse) 14343
Molecular Function:
glycosyltransferase
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support