Hamburger Menu Button
Thermo Fisher Scientific Logo
登入
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Tubes
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO 和 CRO 服務
    • CDMO 服務
    • 臨床試驗 CRO 服務
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • Register for an Account
    • How to Order
    • Instrument Support
    • Technical Support Centers
    • Learning Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • 快速訂購
          • 登入
            登入
            Don't have an account ? Create Account
            • 帳戶
            • 訂單
            • 訂製產品與專案
          • Primary Antibodies ›
          • FZD10 Antibodies

          Invitrogen

          FZD10 Polyclonal Antibody

          View all (9) FZD10 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite FZD10 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (2)
          FZD10 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          FZD10 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 2

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          FZD10 Antibody (PA5-69126) in ICC/IF

          Immunofluorescent analysis of FZD10 in COS7 cells. Sample was treated with FZD10 polyclonal antibody (Product # PA5-69126) with a dilution of 1:333, an anti-rabbit Cy2 secondary antibody using 1:500 dilution, FZD10 and DAPI. {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          FZD10 Antibody in Immunocytochemistry (ICC/IF)
          FZD10 Antibody in Immunocytochemistry (ICC/IF)
          FZD10 Polyclonal Antibody

          Product Details

          PA5-69126

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          1.0 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          1:333
          -
          Product Specifications

          Species Reactivity

          Human

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          synthetic peptide directed towards the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Liquid

          Concentration

          0.5 mg/mL

          Amount

          50 µg

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 2% sucrose

          Contains

          0.09% sodium azide

          Storage conditions

          -20°C, Avoid Freeze/Thaw Cycles

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2688310

          Product Specific Information

          This target displays homology in the following species: Cow: 92%; Dog: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 100%

          Target Information

          FZD10/Frizzled-10 is a 581 amino acid protein belonging to the G-protein coupled receptor Fz/Smo family and containing a signal peptide, a cysteine-rich domain in the N-terminal, seven transmembrane domains and a C-terminal PDZ domain-binding motif. It is involved in transduction, intercellular transmission of polarity information during tissue morphogenesis in differentiated tissues and as a receptor for Wnt proteins. FZD10 is expressed highly in placenta, fetal kidney, fetal lung, brain cerebellum, cerebral cortex, medulla and spinal cord with very low levels in total brain, frontal lobe, temporal lobe, putamen, adult brain, heart, lung and skeletal muscle.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: CD350; CD350 antigen; frizzled 10, seven transmembrane spanning receptor; frizzled family receptor 10; frizzled homolog 10; Frizzled-10; Fz-10; FzE7

          View more View less

          Gene Aliases: CD350; FZ-10; Fz10; FZD10; FzE7; hFz10

          View more View less

          UniProt ID: (Human) Q9ULW2

          View more View less

          Entrez Gene ID: (Human) 11211

          View more View less

          Function(s)
          transmembrane signaling receptor activity G-protein coupled receptor activity protein binding Wnt-protein binding Wnt-activated receptor activity
          Process(es)
          signal transduction cell surface receptor signaling pathway G-protein coupled receptor signaling pathway Wnt signaling pathway neuron differentiation regulation of actin cytoskeleton organization non-canonical Wnt signaling pathway positive regulation of JNK cascade canonical Wnt signaling pathway cellular response to retinoic acid
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-pgj68:80/100.66.79.163:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline