Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
FZD3 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 5
FZD3 Antibody (PA5-79289) in IHC (P)
Immunohistochemistry analysis of FZD3 on paraffin-embedded human mammary cancer tissue. Antigen retrieval was performed using citrate buffer (pH6, epitope retrieval solution) for 20 mins. Sample was blocked using 10% goat serum, incubated with FZD3 polyclonal antibody (Product# PA5-79289) with a dilution of 1 µg/mL (overnight at 4°C), and followed by biotinylated goat anti-rabbit IgG (30 minutes at 37°C). D... View More
Product Details
PA5-79289
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human FZD3 (MPNLLNHYDQQTAALAMEPFHPMVNLDCSRDFRPFL).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human SK-OV-3 cell, human Jurkat cell. IHC: human colon cancer tissue, human mammary cancer tissue, mouse kidney tissue, rat kidney tissue.
Target Information
This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. The function of this protein is unknown, although it may play a role in mammalian hair follicle development.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: frizzled 3; frizzled 3, seven transmembrane spanning receptor; frizzled family receptor 3; frizzled homolog 3; Frizzled-3; Fz-3; hFz3; mFz3
Gene Aliases: AU020229; D930050A07Rik; Fz-3; Fz3; FZD3
UniProt ID: (Human) Q9NPG1, (Mouse) Q61086
Entrez Gene ID: (Human) 7976, (Mouse) 14365, (Rat) 266715
establishment of planar polarity
neuron migration
neural tube closure
hair follicle development
positive regulation of neuroblast proliferation
G-protein coupled receptor signaling pathway
Wnt signaling pathway, calcium modulating pathway
neuron differentiation
cell proliferation in midbrain
non-canonical Wnt signaling pathway
post-anal tail morphogenesis
dopaminergic neuron axon guidance
serotonergic neuron axon guidance
inner ear morphogenesis
negative regulation of mitotic cell cycle, embryonic
canonical Wnt signaling pathway
Wnt signaling pathway, planar cell polarity pathway
sympathetic ganglion development
commissural neuron axon guidance
negative regulation of execution phase of apoptosis
midbrain morphogenesis
signal transduction
cell surface receptor signaling pathway
multicellular organism development
nervous system development
Wnt signaling pathway
midbrain development
brain development
response to drug
response to electrical stimulus
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support