Hamburger Menu Button
Thermo Fisher Scientific Logo
Iniciar sesión
¿No tiene una cuenta? Crear una cuenta
  • Productos
    • Consumibles de laboratorio
    • Equipos de laboratorio
    • Instrumentos de Laboratorio
    • Clínica y Diagnóstico
    • Cromatografía
    • Espectrometría de Masas
    • Cultivo Celular
    • Análisis Celular
    • Anticuerpos
    • Ver todas las categorías de producto
  • Aplicaciones
    • Cultivo celular y transfección
    • Citometría de flujo
    • Investigación sobre el cáncer
    • Cromatografía
    • Secuenciación
    • PCR
    • Soluciones para laboratorio
    • Diagnóstico de alergias
    • Ver todas las aplicaciones y técnicas
  • Servicios
    • Servicios Personalizados
    • Servicios de Capacitación
    • Informática para laboratorios de ámbito empresarial
    • Servicios financieros y de arrendamiento
    • Servicios 360° de CDMO y CRO
    • Servicios de CDMO
    • Servicios de CRO
    • Ver todos los servicios
  • Ayuda y Soporte
    • Crear una nueva cuenta
    • Cómo hacer el pedido
    • Póngase en contacto con nosotros
    • Cambio de ubicación
    • Ver toda la ayuda y soporte técnico
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • A quiénes brindamos nuestros servicios
    • Industria biotecnológica
    • Sector biofarmacéutico
    • CDMO
    • Diagnósticos de laboratorio
    • Ciencias aplicadas e industriales
  • Ofertas especiales
  • Contáctenos
  • Orden Rápida
  • Documentos y certificados
Thermo Fisher Scientific Logo

Search

Buscar
Search button
          • Contáctenos
          • Orden Rápida
          • Iniciar sesión
            Iniciar sesión
            ¿No tiene una cuenta? Crear una cuenta
            • Cuenta
            • Pedidos
            • Productos y proyectos personalizados
          • Primary Antibodies ›
          • GREM1 Antibodies

          Invitrogen

          GREM1 Polyclonal Antibody

          View all (24) GREM1 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite GREM1 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (1)
          GREM1 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          GREM1 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 1

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          GREM1 Antibody (PA5-79324) in WB

          Western blot analysis of GREM1 using GREM1 Polyclonal Antibody (Product # PA5-79324). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 µg of sample under reducing conditions. Lane 1: human A549 whole cell lysates. Lane 2: rat testis tissue lysates. Lane 3: mouse testis tissue lysates. After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          GREM1 Antibody in Western Blot (WB)
          GREM1 Polyclonal Antibody

          Product Details

          PA5-79324

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human Gremlin 1 (151-184aa TMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746440

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human A549 whole cell, rat testis tissue, mouse testis tissue.

          Target Information

          In Xenopus, Gremlin belongs to a novel gene family that act as BMP antagonists in embryonic explants. The human homolog of Drm/Gremlin (CKTFS1B1) is localized on human chromosome 15q13--> q15. DRM-specific mRNA is expressed in different human tissues, including brain, ovary, intestine and colon. It has been suggested that down-regulation of DRM is associated with tumor progression, and support the hypothesis that human DRM may play an important role during both neuroembryological development and carcinogenesis.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: BMP antagonist; BMP antagonist; Dan family member; Cell proliferation-inducing gene 2 protein; colorectal adenoma and carcinoma 1; Cysteine knot superfamily 1, BMP antagonist 1; DAN domain family member 2; Down-regulated in Mos-transformed cells protein; down-regulated in v-mos-transformed cells; gremlin; gremlin 1 homolog, cysteine knot superfamily; gremlin 1, cysteine knot superfamily, homolog; gremlin 1-like protein; Gremlin-1; hereditary mixed polyposis syndrome; IHG-2; Increased in high glucose protein 2; increased in high glucose-2; PIG2; unnamed protein product

          View more View less

          Gene Aliases: C15DUPq; CKTSF1B1; CRAC1; CRCS4; DAND2; DRM; DUP15q; Grem; GREM1; GREMLIN; HMPS; HMPS1; IHG-2; ld; MPSH; PIG2

          View more View less

          UniProt ID: (Human) O60565, (Rat) O35793, (Mouse) O70326

          View more View less

          Entrez Gene ID: (Human) 26585, (Rat) 50566, (Mouse) 23892

          View more View less

          Function(s)
          cytokine activity protein binding morphogen activity transmembrane receptor protein tyrosine kinase activator activity BMP binding protein homodimerization activity vascular endothelial growth factor receptor 2 binding receptor agonist activity heparan sulfate proteoglycan binding
          Process(es)
          cell morphogenesis angiogenesis cell migration involved in sprouting angiogenesis positive regulation of receptor internalization mesenchymal to epithelial transition involved in metanephros morphogenesis signal transduction cell-cell signaling positive regulation of cell proliferation organ morphogenesis proximal/distal pattern formation regulation of epithelial to mesenchymal transition collagen fibril organization embryonic limb morphogenesis negative regulation of bone mineralization negative regulation of BMP signaling pathway negative regulation of chondrocyte differentiation regulation of stress-activated MAPK cascade negative regulation of osteoblast proliferation sequestering of BMP from receptor via BMP binding negative regulation of apoptotic process endothelial cell migration negative regulation of osteoblast differentiation positive regulation of angiogenesis negative regulation of transcription, DNA-templated positive regulation of transcription, DNA-templated positive regulation of transcription from RNA polymerase II promoter negative regulation of bone remodeling determination of dorsal identity regulation of focal adhesion assembly cardiac muscle cell differentiation limb development cardiac muscle cell myoblast differentiation negative regulation of SMAD protein import into nucleus ureteric bud formation signal transduction by p53 class mediator negative regulation of monocyte chemotaxis positive regulation of cell migration involved in sprouting angiogenesis negative regulation of canonical Wnt signaling pathway positive regulation of branching involved in ureteric bud morphogenesis negative regulation of osteoclast proliferation negative regulation of bone trabecula formation negative regulation of bone mineralization involved in bone maturation positive regulation of vascular endothelial growth factor signaling pathway positive regulation of NIK/NF-kappaB signaling branching involved in ureteric bud morphogenesis negative regulation of leukocyte chemotaxis positive regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation apoptotic process activation of transmembrane receptor protein tyrosine kinase activity negative regulation of cell growth positive regulation of NF-kappaB import into nucleus positive regulation of NF-kappaB transcription factor activity positive regulation of telomerase activity negative regulation of pathway-restricted SMAD protein phosphorylation positive regulation of protein tyrosine kinase activity negative regulation of branching involved in ureteric bud morphogenesis positive regulation of peptidyl-tyrosine autophosphorylation positive regulation of receptor activity positive regulation of cardiac muscle cell differentiation
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Pedidos Plus Icon Minus Icon
          • Estatus del pedido
          • Ayuda para pedidos
          • Orden Rápida
          • Supply Center
          • eProcurement
          Soporte Plus Icon Minus Icon
          • Ayuda y soporte
          • Entre en Contacto
          • Centros de asistencia técnica
          • Consultar documentos y certificados
          • Informar de un problema en la web
          Recursos Plus Icon Minus Icon
          • Centros de aprendizaje
          • Promociones
          • Eventos & Webinars
          • Medios Sociales
          Acerca de Thermo Fisher Plus Icon Minus Icon
          • Acerca de nosotros Acerca de nosotros
          • Empleo Empleo
          • Inversores Inversores
          • Noticias Noticias
          • Responsabilidad social Responsabilidad social
          • Marcas comerciales
          • Políticas y avisos
          Nuestro Portafolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Chile flag icon
          Chile

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-5cvsx:80/100.66.79.163:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline