Search

  • 訂單查詢
  • 快速訂購

Invitrogen

GREM1 Polyclonal Antibody

View all (24) GREM1 antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Additional Information:
{{banner.description}}
{{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
GREM1 Polyclonal Antibody

Product Details

PA5-79324

Applications
Tested Dilution
Publications

Western Blot (WB)

0.1-0.5 µg/mL
-
Product Specifications

Species Reactivity

Human, Mouse, Rat

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human Gremlin 1 (151-184aa TMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD).
3D Epitope / Immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Amount

100 µg

Purification

Antigen affinity chromatography

Storage buffer

PBS with 4mg trehalose

Contains

no preservative

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_2746440

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - WB: human A549 whole cell, rat testis tissue, mouse testis tissue.

Target Information

In Xenopus, Gremlin belongs to a novel gene family that act as BMP antagonists in embryonic explants. The human homolog of Drm/Gremlin (CKTFS1B1) is localized on human chromosome 15q13--> q15. DRM-specific mRNA is expressed in different human tissues, including brain, ovary, intestine and colon. It has been suggested that down-regulation of DRM is associated with tumor progression, and support the hypothesis that human DRM may play an important role during both neuroembryological development and carcinogenesis.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: BMP antagonist; BMP antagonist; Dan family member; Cell proliferation-inducing gene 2 protein; colorectal adenoma and carcinoma 1; Cysteine knot superfamily 1, BMP antagonist 1; DAN domain family member 2; Down-regulated in Mos-transformed cells protein; down-regulated in v-mos-transformed cells; gremlin; gremlin 1 homolog, cysteine knot superfamily; gremlin 1, cysteine knot superfamily, homolog; gremlin 1-like protein; Gremlin-1; hereditary mixed polyposis syndrome; IHG-2; Increased in high glucose protein 2; increased in high glucose-2; PIG2; unnamed protein product

View more View less

Gene Aliases: C15DUPq; CKTSF1B1; CRAC1; CRCS4; DAND2; DRM; DUP15q; Grem; GREM1; GREMLIN; HMPS; HMPS1; IHG-2; ld; MPSH; PIG2

View more View less

UniProt ID: (Human) O60565, (Rat) O35793, (Mouse) O70326

View more View less

Entrez Gene ID: (Human) 26585, (Rat) 50566, (Mouse) 23892

View more View less

Function(s)
cytokine activity protein binding morphogen activity transmembrane receptor protein tyrosine kinase activator activity BMP binding protein homodimerization activity vascular endothelial growth factor receptor 2 binding receptor agonist activity heparan sulfate proteoglycan binding
Process(es)
cell morphogenesis angiogenesis cell migration involved in sprouting angiogenesis positive regulation of receptor internalization mesenchymal to epithelial transition involved in metanephros morphogenesis signal transduction cell-cell signaling positive regulation of cell proliferation organ morphogenesis proximal/distal pattern formation regulation of epithelial to mesenchymal transition collagen fibril organization embryonic limb morphogenesis negative regulation of bone mineralization negative regulation of BMP signaling pathway negative regulation of chondrocyte differentiation regulation of stress-activated MAPK cascade negative regulation of osteoblast proliferation sequestering of BMP from receptor via BMP binding negative regulation of apoptotic process endothelial cell migration negative regulation of osteoblast differentiation positive regulation of angiogenesis negative regulation of transcription, DNA-templated positive regulation of transcription, DNA-templated positive regulation of transcription from RNA polymerase II promoter negative regulation of bone remodeling determination of dorsal identity regulation of focal adhesion assembly cardiac muscle cell differentiation limb development cardiac muscle cell myoblast differentiation negative regulation of SMAD protein import into nucleus ureteric bud formation signal transduction by p53 class mediator negative regulation of monocyte chemotaxis positive regulation of cell migration involved in sprouting angiogenesis negative regulation of canonical Wnt signaling pathway positive regulation of branching involved in ureteric bud morphogenesis negative regulation of osteoclast proliferation negative regulation of bone trabecula formation negative regulation of bone mineralization involved in bone maturation positive regulation of vascular endothelial growth factor signaling pathway positive regulation of NIK/NF-kappaB signaling branching involved in ureteric bud morphogenesis negative regulation of leukocyte chemotaxis positive regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation apoptotic process activation of transmembrane receptor protein tyrosine kinase activity negative regulation of cell growth positive regulation of NF-kappaB import into nucleus positive regulation of NF-kappaB transcription factor activity positive regulation of telomerase activity negative regulation of pathway-restricted SMAD protein phosphorylation positive regulation of protein tyrosine kinase activity negative regulation of branching involved in ureteric bud morphogenesis positive regulation of peptidyl-tyrosine autophosphorylation positive regulation of receptor activity positive regulation of cardiac muscle cell differentiation
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support