Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Cell Analysis
    • Antibodies
    • Mass Spectrometry
    • Cell Culture
    • Laboratory Instruments
    • Clinical and Diagnostics
    • Chromatography
    • Laboratory Equipment
    • Laboratory Supplies
    • Molecular Biology and Nucleic Acid Analysis
    • Sequence-Specific Nucleic Acid Products
    • See all product categories
  • Applications
    • Cell Culture and Transfection
    • Flow Cytometry
    • Cancer Research
    • Chromatography
    • Sequencing
    • PCR
    • Lab Solutions
    • Allergy Diagnostics
    • See all applications and techniques
  • Services
    • Cell Biology Services
    • Custom Services
    • Training Services
    • Lab Informatics Services
    • Financial and Leasing Services
    • Partnering and Licensing Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Food Safety Inspection Services
    • See all services
  • Help and Support
    • How to Order
    • Promotions and Online Offers
    • Contact Us
    • Change Location
    • Create a New Account
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Special Offers
  • Contact Us
  • Quick Order
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Contact Us
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Custom Products & Projects
          • Primary Antibodies ›
          • H-Ras Antibodies

          Invitrogen

          H-Ras Polyclonal Antibody

          View all (25) H-Ras antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite H-Ras Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (2)
          H-Ras Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          H-Ras Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 2

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          H-Ras Antibody (PA5-94930) in IHC (P)

          Immunohistochemical analysis of GTPase HRAS in paraffin-embedded section of mouse intestine tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/mL rabbit anti-GTPase HRAS antibody (Product # PA5-94930) overnight at 4°C. Biotinylated goat anti-r... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          H-Ras Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          H-Ras Antibody in Western Blot (WB)
          H-Ras Polyclonal Antibody

          Product Details

          PA5-94930

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human GTPase HRAS (101-137aa KRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLAR SY).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2806736

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: Rat Brain Tissue, Mouse Brain Tissue, HEPA whole cell. IHC: mouse intestine tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          Monomeric G protein Ras functions as a molecular switch linking receptor and nonreceptor tyrosine kinase activation to a number of downstream signaling pathways leading to distinct cytoplasmic or nuclear events. Each mammalian cell contains three Ras proto-oncogene coding for closely related Ras proteins: H-, K-, N-Ras. Oncogenic mutations in Ras genes are present in ~30% of all human cancers. Constitutive activation of Ras due to mutations or overexpression stimulates proliferation and inhibition of apoptosis. K-Ras mutations are common in pancreatic, colorectal and nonsmall-cell lung carcinomas; H-Ras mutations are common in bladder, kidney and thyroid carcinomas; N-Ras mutations are found in melanoma, hematological malignancies and hepatocellular carcinaoma.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: c-H-ras; c-Ha-ras p21 protein; c-Ha-ras transgene; c-has/bas p21 protein; GTP- and GDP-binding peptide B; GTPase HRas; GTPase Hras1; H-ras 1 protein; H-Ras-1; Ha-Ras; Ha-Ras1 proto-oncoprotein; Harvey ras1 protein; Harvey rat sarcoma viral (v-Ha-ras) oncogene homolog; Harvey rat sarcoma viral oncogene homolog; Harvey rat sarcoma viral oncoprotein; Harvey rat sarcoma virus oncogene 1; HRAS; p19 H-RasIDX protein; p21ras; Ras family small GTP binding protein H-Ras; small GTP binding protein; transformation gene: oncogene HAMSV; Transforming protein p21; v-Ha-ras Harvey rat sarcoma viral oncogene homolog

          View more View less

          Gene Aliases: C-BAS/HAS; C-H-RAS; c-Ha-ras; C-HA-RAS1; c-rasHa; CTLO; H-ras; H-RASIDX; Ha-ras; HAMSV; Harvey-ras; HRAS; Hras-1; HRAS1; Kras2; p21ras; ras; RASH1

          View more View less

          UniProt ID: (Human) P01112, (Mouse) Q61411, (Rat) P20171

          View more View less

          Entrez Gene ID: (Human) 3265, (Mouse) 15461, (Rat) 293621

          View more View less

          Function(s)
          nucleotide binding GTPase activity obsolete small monomeric GTPase activity protein binding GTP binding hydrolase activity GDP binding protein anchor phospholipase C activator activity protein C-terminus binding small GTPase
          Process(es)
          MAPK cascade regulation of transcription from RNA polymerase II promoter endocytosis chemotaxis signal transduction cell surface receptor signaling pathway small GTPase mediated signal transduction Ras protein signal transduction positive regulation of cell proliferation negative regulation of cell proliferation insulin receptor signaling pathway organ morphogenesis positive regulation of gene expression negative regulation of gene expression Schwann cell development positive regulation of cell migration positive regulation of interferon-gamma production regulation of actin cytoskeleton organization T-helper 1 type immune response regulation of cell proliferation myelination defense response to protozoan positive regulation of MAPK cascade negative regulation of neuron apoptotic process positive regulation of transcription from RNA polymerase II promoter positive regulation of JNK cascade fibroblast proliferation positive regulation of fibroblast proliferation regulation of long-term neuronal synaptic plasticity positive regulation of epithelial cell proliferation T cell receptor signaling pathway neuron apoptotic process regulation of cell cycle adipose tissue development positive regulation of ERK1 and ERK2 cascade cellular response to gamma radiation positive regulation of wound healing positive regulation of protein targeting to membrane cellular senescence oncogene-induced cell senescence intrinsic apoptotic signaling pathway regulation of neurotransmitter receptor localization to postsynaptic specialization membrane positive regulation of ruffle assembly positive regulation of miRNA metabolic process positive regulation of protein phosphorylation apoptotic process cell cycle arrest mitotic cell cycle checkpoint cell aging cell proliferation negative regulation of GTPase activity positive regulation of MAP kinase activity positive regulation of GTPase activity positive regulation of DNA replication positive regulation of Ras protein signal transduction protein heterooligomerization positive regulation of actin cytoskeleton reorganization visual learning actin cytoskeleton organization regulation of synaptic transmission, GABAergic positive regulation of Rac protein signal transduction social behavior negative regulation of cell differentiation striated muscle cell differentiation epithelial tube branching involved in lung morphogenesis
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Responsibility Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          México flag icon
          México

          Your items have has been added!


          Host server : magellan-search-green-7d94cb4b65-4lm45:80/100.66.75.98:80.
          git-commit: c9e08c96761173abe34e68f880379696776a4827
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.44.1-2026.02.97.1.0