Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Productos
    • Anticuerpos
    • Oligonucleótidos, cebadores, sondas y genes
    • Ensayos de PCR en tiempo real TaqMan
    • Medios de cultivos celulares
    • Productos químicos
    • Columnas y cartuchos de cromatografía
    • Equipo de laboratorio
    • Material de plástico y suministros para laboratorio
    • Microplacas
    • Productos más ecológicos
    • Ver todas las categorías de productos
  • Applications
    • Bioprocesamiento
    • Cultivo celular y transfección
    • Terapia celular y génica
    • Cromatografía
    • Pruebas moleculares
    • Soluciones digitales
    • Extracción y análisis de ADN y ARN
    • Espectroscopía, análisis elemental y de isótopos
    • Ver todas las aplicaciones y técnicas
  • Servicios
    • Servicios 360° de CDMO y CRO
    • Servicios de CDMO
    • Servicios de CRO
    • Servicios personalizados
    • Servicios de leasing y financiación
    • Servicios de instrumentos
    • Informática de laboratorio
    • OEM y oferta comercial
    • Servicios de formación
    • Unity Lab Services
    • Ver todos los servicios
  • Ayuda y soporte técnico
    • Regístrese para obtener una cuenta
    • Cómo hacer un pedido
    • Asistencia para el instrumental
    • Centros de soporte técnico
    • Centros de formación
    • Vea todos los temas de ayuda y soporte técnico
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • A quiénes brindamos nuestros servicios
    • Industria biotecnológica
    • Sector biofarmacéutico
    • CDMO
    • Diagnósticos de laboratorio
    • Ciencias aplicadas e industriales
  • Promociones
  • Contacto
  • Pedido rápido
  • Estado del pedido y seguimiento
  • Documentos y certificados
Thermo Fisher Scientific Logo

Search

Buscar
Search button
          • Estado del pedido
          • Pedido rápido
          • Promos
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Cuenta
            • Pedidos
            • Connect: laboratorio, datos, aplicaciones
            • Productos y proyectos personalizados
            • Services Central
          • Primary Antibodies ›
          • FGF8 Antibodies

          Abnova

          FGF8 Monoclonal Antibody (3B10)

          View all (17) FGF8 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite FGF8 Monoclonal Antibody (3B10)

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (1)
          FGF8 Antibody in ELISA (ELISA)
          Group 53 Created with Sketch.
          FGF8 Antibody in ELISA (ELISA)
          Group 53 Created with Sketch.

          FIGURE: 1 / 1

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          FGF8 Antibody (H00002253-M04) in ELISA

          Detection limit for recombinant GST tagged FGF8 is approximately 1 ng/mL as a capture antibody. {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          FGF8 Antibody in ELISA (ELISA)
          FGF8 Monoclonal Antibody (3B10)

          Product Details

          H00002253-M04

          Applications
          Tested Dilution
          Publications

          ELISA (ELISA)

          1 ng/mL
          -
          Product Specifications

          Species Reactivity

          Human

          Host/Isotype

          Mouse / IgG2a, kappa

          Class

          Monoclonal

          Type

          Antibody

          Clone

          3B10

          Immunogen

          FGF8 (NP_149354, 65 a.a. approximately 133 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Liquid

          Concentration

          See Label

          Amount

          100 µg

          Purification

          Affinity chromatography

          Storage buffer

          PBS, pH 7.4

          Contains

          no preservative

          Storage conditions

          -20°C, Avoid Freeze/Thaw Cycles

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          Product Specific Information

          Sequence of this protein is as follows: SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSR VRVRGAETGLYICMNKKGK

          Target Information

          Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. Required for normal brain, eye, ear and limb development during embryogenesis. Required for normal development of the gonadotropin-releasing hormone (GnRH) neuronal system. Plays a role in neurite outgrowth in hippocampal cells.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: AIGF; androgen-induced; Androgen-induced growth factor; FGF; FGF-8; Fibroblast growth factor; Fibroblast growth factor 8; fibroblast growth factor 8 (androgen-induced); HBGF-8; Heparin-binding growth factor 8; MGC149376

          View more View less

          Gene Aliases: AIGF; FGF-8; FGF8; HBGF-8; HH6; KAL6

          View more View less

          UniProt ID: (Human) P55075

          View more View less

          Entrez Gene ID: (Human) 2253

          View more View less

          Function(s)
          type 1 fibroblast growth factor receptor binding type 2 fibroblast growth factor receptor binding growth factor activity chemoattractant activity
          Process(es)
          MAPK cascade patterning of blood vessels metanephros development branching involved in ureteric bud morphogenesis organ induction kidney development mesonephros development neural plate morphogenesis heart looping blood vessel remodeling heart morphogenesis outflow tract septum morphogenesis outflow tract morphogenesis epithelial to mesenchymal transition involved in endocardial cushion formation apoptotic process response to oxidative stress signal transduction determination of left/right symmetry gastrulation heart development motor neuron axon guidance mesodermal cell migration cell proliferation positive regulation of cell proliferation gonad development fibroblast growth factor receptor signaling pathway response to xenobiotic stimulus anatomical structure morphogenesis embryo development ending in birth or egg hatching dorsal/ventral pattern formation positive regulation of gene expression telencephalon development pallium development subpallium development forebrain dorsal/ventral pattern formation cell proliferation in forebrain forebrain neuron development central nervous system neuron development neurogenesis signal transduction involved in regulation of gene expression cell differentiation lung development regulation of cell migration male genitalia development thyroid gland development otic vesicle formation midbrain-hindbrain boundary development dorsal/ventral axon guidance embryonic heart tube development limb morphogenesis embryonic hindlimb morphogenesis organ growth aorta morphogenesis inner ear morphogenesis odontogenesis regulation of odontogenesis of dentin-containing tooth negative regulation of apoptotic process positive regulation of MAPK cascade negative regulation of neuron apoptotic process cell fate commitment positive regulation of cell differentiation positive regulation of G-protein coupled receptor protein signaling pathway positive regulation of mitotic nuclear division positive regulation of organ growth generation of neurons embryonic neurocranium morphogenesis forebrain morphogenesis positive chemotaxis neuron apoptotic process positive regulation of cell division negative regulation of cardiac muscle tissue development pharyngeal system development corticotropin hormone secreting cell differentiation thyroid-stimulating hormone-secreting cell differentiation bone development lung morphogenesis branching involved in salivary gland morphogenesis neuroepithelial cell differentiation positive regulation of ERK1 and ERK2 cascade dopaminergic neuron differentiation stem cell proliferation cell migration involved in mesendoderm migration larynx morphogenesis mitotic nuclear division positive regulation of stem cell proliferation
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Pedidos Plus Icon Minus Icon
          • Estado del pedido
          • Ayuda con el pedido
          • Pedido rápido
          • Centro de suministros
          • eProcurement (B2B)
          Asistencia Plus Icon Minus Icon
          • Ayuda y soporte técnico
          • Contacto
          • Centros de soporte técnico
          • Documentos y certificados
          • Informar de un problema del sitio web
          Recursos Plus Icon Minus Icon
          • Centros de formación
          • Promociones
          • Eventos y seminarios web
          • Redes sociales
          Acerca de Thermo Fisher Plus Icon Minus Icon
          • Acerca de nosotros Acerca de nosotros
          • Carreras profesionales Carreras profesionales
          • Inversores Inversores
          • Noticias Noticias
          • Responsabilidad social Responsabilidad social
          • Marcas registradas
          • Políticas y avisos
          Nuestra cartera Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Spain flag icon
          Spain

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-9fm2r:80/100.66.79.29:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline