Synthetic peptide sequence: NRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPA).
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
Hyaluronic acid is a high molecular weight unbranched polysaccharide synthesized by a wide variety of organisms from bacteria to mammals, and is a constituent of the extracellular matrix. It consists of alternating glucuronic acid and N-acetylglucosamine residues that are linked by beta-1-3 and beta-1-4 glycosidic bonds. HA is synthesized by membrane-bound synthase at the inner surface of the plasma membrane, and the chains are extruded through pore-like structures into the extracellular space. It serves a variety of functions, including space filling, lubrication of joints, and provision of a matrix through which cells can migrate. HA is actively produced during wound healing and tissue repair to provide a framework for ingrowth of blood vessels and fibroblasts. Changes in the serum concentration of HA are associated with inflammatory and degenerative arthropathies such as rheumatoid arthritis. In addition, the interaction of HA with the leukocyte receptor CD44 is important in tissue-specific homing by leukocytes, and overexpression of HA receptors has been correlated with tumor metastasis. HAS1 is a member of the newly identified vertebrate gene family encoding putative hyaluronan synthases, and its amino acid sequence shows significant homology to the hasA gene product of Streptococcus pyogenes.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: HA synthase 1; huHAS1; Hyaluronan synthase 1; Hyaluronate synthase 1; Hyaluronic acid synthase 1
Gene Aliases: HAS; HAS1
UniProt ID: (Human) Q92839, (Mouse) Q61647
Entrez Gene ID: (Human) 3036, (Mouse) 15116, (Rat) 282821
Molecular Function:
glycosyltransferase
transferase
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support