Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
HDGF Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 7
HDGF Antibody (PA5-79355) in ICC/IF
Immunocytochemistry analysis of HDGF using anti-HDGF antibody (Product # PA5-79355) . HDGF was detected in a section of U2OS cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 2μg/mL rabbit anti-HDGF antibody (Product # PA5-79355) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visua... View More
Product Details
PA5-79355
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human HDGF (61-97aa KDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKA).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human A549 whole cell, human 293T whole cell, human Hela whole cell, rat C6 whole cell. IHC: mouse liver tissue, rat liver tissue, human intestinal cancer tissue, human lung cancer tissue. ICC/IF: U20S cell. Flow: A431 cell.
Target Information
HDGF is a member of the hepatoma-derived growth factor family. This protein has mitogenic and DNA-binding activity and may play a role in cellular proliferation and differentiation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: DKFZp686J1764; FLJ96580; HDGF; Hepatoma-derived growth factor; High mobility group protein 1-like 2; HMG-1L2
Gene Aliases: AI118077; D3Ertd299e; HDGF; HMG1L2; Tdrm1
UniProt ID: (Human) P51858, (Rat) Q8VHK7, (Mouse) P51859
Entrez Gene ID: (Human) 3068, (Rat) 114499, (Mouse) 15191
nucleotide binding
RNA polymerase II transcription corepressor activity
transcription corepressor binding
DNA binding
growth factor activity
heparin binding
poly(A) RNA binding
RNA polymerase II core promoter proximal region sequence-specific DNA binding
transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding
protein binding
transcription cofactor
negative regulation of transcription from RNA polymerase II promoter
transcription, DNA-templated
signal transduction
cell proliferation
IRE1-mediated unfolded protein response
cellular process
protein localization to nucleus
positive regulation of transcription from RNA polymerase II promoter
regulation of transcription, DNA-templated
transcription from RNA polymerase II promoter
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support