Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Promotions
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Promos
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central
          • Primary Antibodies ›
          • HMGB1 Antibodies

          Invitrogen

          HMGB1 Polyclonal Antibody

          Advanced Verification
          View all (64) HMGB1 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers

          Cite HMGB1 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (13)
          • Advanced Verification (1)
          HMGB1 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          HMGB1 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 14

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          HMGB1 Antibody (PA5-79373) in ICC/IF

          Immunocytochemistry analysis of HMGB1 using anti-HMGB1 antibody (Product # PA5-79373). HMGB1 was detected in a section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 2μg/mL rabbit anti-HMGB1 antibody (Product # PA5-79373) overnight at 4°C. DyLight®594 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Vi... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          HMGB1 Antibody in Immunocytochemistry (ICC/IF)
          HMGB1 Antibody in Immunocytochemistry (ICC/IF)
          HMGB1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          HMGB1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          HMGB1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          HMGB1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          HMGB1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          HMGB1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          HMGB1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          HMGB1 Antibody in Western Blot (WB)
          HMGB1 Antibody in Western Blot (WB)
          HMGB1 Antibody in Western Blot (WB)
          HMGB1 Antibody in Flow Cytometry (Flow)
          HMGB1 Antibody
          HMGB1 Polyclonal Antibody

          Product Details

          PA5-79373

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          2 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human HMGB1 (124-154aa DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746489

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human Hela whole cell, human 293T whole cell, human K562 whole cell, human Jurkat whole cell, rat brain tissue, mouse brain tissue, mouse RAW264.7 whole cell. IHC: mouse intestine tissue, mouse liver tissue, rat intestine tissue, rat liver tissue, human mammary cancer tissue, human placenta tissue,. ICC/IF: U20S cell, A431 cell. Flow: THP-1 cell.

          Target Information

          High-mobility group box 1 protein, previously known as HMG-1 or amphoterin, is a member of the high mobility group box family of non-histone chromosomal proteins. Human HMGB1 is expressed as a 30 kDa, 215 amino acid (aa) single chain polypeptide containing three domains: two N-terminal globular, 70 aa positively charged DNA-binding domains (HMG boxes A and B), and a negatively charged 30 aa C-terminal region that contains only Asp and Glu. HMGB1 is expressed at high levels in almost all cells. It was originally discovered as a nuclear protein that could bend DNA. Such bending stabilizes nucleosome formation and regulates the expression of select genes upon recruitment by DNA binding proteins. It is now known that HMGB1 can also act extracellularly, both as an inflammatory mediator that promotes monocyte migration and cytokine secretion, and as a mediator of T cell-dendritic cell interaction. Moreover, HMGB1 is reported that the level of HMGB1 is elevated during sterile tissue injury, infection, lethal endotoxemia or sepsis, collagen-induced arthritis, and ischemia-reperfusion induced tissue injury.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: Amphoterin; Amphoterin antibody; DKFZp686A04236; Heparin-binding protein p30; high mobility group 1; High mobility group protein 1; High mobility group protein B1; high-mobility group (nonhistone chromosomal) protein 1; HMG-1; HMG3 antibody; hmgb 1; hmgb-1; HMGB1; RP11-550P23.1; Sulfoglucuronyl carbohydrate binding protein; unnamed protein product

          View more View less

          Gene Aliases: Ac2-008; amphoterin; DEF; HMG-1; HMG1; HMG3; HMGB1; p30; SBP-1

          View more View less

          UniProt ID: (Human) P09429, (Rat) P63159, (Mouse) P63158

          View more View less

          Entrez Gene ID: (Human) 3146, (Rat) 25459, (Mouse) 15289

          View more View less

          Function(s)
          four-way junction DNA binding bubble DNA binding transcription regulatory region sequence-specific DNA binding lipopolysaccharide binding phosphatidylserine binding DNA binding damaged DNA binding double-stranded DNA binding single-stranded DNA binding transcription coactivator activity transcription corepressor activity RNA binding double-stranded RNA binding single-stranded RNA binding cytokine activity integrin binding protein binding lipid binding DNA binding, bending calcium-dependent protein kinase regulator activity lyase activity C-X-C chemokine binding protein kinase activator activity chemoattractant activity receptor agonist activity RAGE receptor binding RNA polymerase II sequence-specific DNA binding transcription factor binding DNA polymerase binding supercoiled DNA binding DNA-binding transcription factor binding open form four-way junction DNA binding crossed form four-way junction DNA binding bent DNA binding chromatin binding transcription factor activity, sequence-specific DNA binding 5S rRNA binding transcription factor binding heparin binding peptide binding poly(A) RNA binding protein dimerization activity glycolipid binding repressing transcription factor binding
          Process(es)
          negative regulation of transcription from RNA polymerase II promoter eye development myeloid dendritic cell activation endothelial cell proliferation positive regulation of endothelial cell proliferation activation of innate immune response adaptive immune response plasmacytoid dendritic cell activation macrophage activation involved in immune response myeloid progenitor cell differentiation immune system process dendritic cell chemotaxis inflammatory response to antigenic stimulus regulation of tolerance induction regulation of T cell mediated immune response to tumor cell glycogen catabolic process DNA metabolic process DNA topological change DNA repair base-excision repair double-strand break repair double-strand break repair via nonhomologous end joining DNA recombination chromatin organization chromatin remodeling transcription from RNA polymerase II promoter autophagy chemotaxis inflammatory response immune response cellular response to DNA damage stimulus signal transduction positive regulation of cytosolic calcium ion concentration positive regulation of autophagy negative regulation of endothelial cell migration negative regulation of RNA polymerase II transcriptional preinitiation complex assembly myeloid cell differentiation lung development neuron projection development heterochromatin assembly regulation of restriction endodeoxyribonuclease activity DNA geometric change positive regulation of mismatch repair negative regulation of interferon-gamma production positive regulation of chemokine production positive regulation of interferon-alpha production positive regulation of interferon-beta production positive regulation of interleukin-1 beta production positive regulation of interleukin-1 production positive regulation of interleukin-10 production positive regulation of interleukin-12 production positive regulation of interleukin-6 production positive regulation of interleukin-8 production positive regulation of tumor necrosis factor production V(D)J recombination positive regulation of toll-like receptor 2 signaling pathway positive regulation of toll-like receptor 4 signaling pathway positive regulation of toll-like receptor 9 signaling pathway T-helper 1 cell activation endothelial cell chemotaxis positive regulation of activated T cell proliferation positive regulation of apoptotic process apoptotic cell clearance negative regulation of CD4-positive, alpha-beta T cell differentiation positive regulation of DNA binding positive regulation of MAPK cascade positive regulation of blood vessel endothelial cell migration negative regulation of blood vessel endothelial cell migration T-helper 1 cell differentiation innate immune response positive regulation of innate immune response positive regulation of cell differentiation positive regulation of myeloid cell differentiation positive regulation of glycogen catabolic process positive regulation of transcription from RNA polymerase II promoter positive regulation of JNK cascade positive regulation of viral entry into host cell cell development regulation of viral process positive chemotaxis regulation of DNA metabolic process response to glucocorticoid positive regulation of ERK1 and ERK2 cascade cellular response to lipopolysaccharide positive regulation of monocyte chemotactic protein-1 production positive regulation of monocyte chemotaxis positive regulation of wound healing neutrophil clearance cellular response to interleukin-7 positive regulation of NIK/NF-kappaB signaling positive regulation of sprouting angiogenesis regulation of hemopoiesis positive regulation of myeloid progenitor cell differentiation positive regulation of vascular endothelial cell proliferation positive regulation of chemokine (C-X-C motif) ligand 2 production negative regulation of apoptotic cell clearance regulation of nucleotide-excision repair positive regulation of dendritic cell differentiation cell morphogenesis positive regulation of protein phosphorylation positive regulation of mesenchymal cell proliferation base-excision repair, DNA ligation regulation of transcription, DNA-templated regulation of transcription from RNA polymerase II promoter nervous system development circadian rhythm negative regulation of DNA replication positive regulation of cell proliferation response to heat response to glucose positive regulation of cell death positive regulation of neuron projection development positive regulation of smooth muscle cell migration positive regulation of cell migration actin cytoskeleton reorganization response to lipopolysaccharide response to insulin positive regulation of myeloid cell apoptotic process response to interferon-gamma response to drug positive regulation of cysteine-type endopeptidase activity involved in apoptotic process positive regulation of myoblast differentiation positive regulation of protein kinase activity positive regulation of mitotic cell cycle regulation of inflammatory response male-specific defense response to bacterium induction of positive chemotaxis myoblast proliferation cellular response to interleukin-1
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy Consumer Health Data Privacy Policy
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Notice
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-blue-64dd947b88-zdkzh:80/100.66.76.145:80.
          git-commit: 0f46c0ba67a87c24f5ac662a3edafcaba07cd08c
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.45.0-Offline