Display Info:
cookie.CK_ISO_CODE.value:us
cookie.CK_LANG_CODE.value:en
cookie.CK_DISPLAY_TYPE.value:
pageContext.request:org.apache.struts2.dispatcher.StrutsRequestWrapper@5cbf052c
Request attributes: pageContext.request.scheme:http(not used)
syndicationProtocol:https
syndicationExtensionPrefix:
syndicationDisplayType:

Invitrogen

HMGB2 Polyclonal Antibody

View all (11) HMGB2 antibodies
635D49A6-4B57-425E-8DC4-6BA1AEB7B473 Created with sketchtool. Datasheet
433BB748-DC81-4FE4-83AD-384F97313745 Created with sketchtool. Create Citation
C488C313-B559-4BFD-B17D-A8B65492815A Created with sketchtool. Tech Support
635D49A6-4B57-425E-8DC4-6BA1AEB7B473 Created with sketchtool. Datasheet
433BB748-DC81-4FE4-83AD-384F97313745 Created with sketchtool. Create Citation
C488C313-B559-4BFD-B17D-A8B65492815A Created with sketchtool. Tech Support

Product Details

Tested Applications
Dilution
Immunohistochemistry (Paraffin) (IHC (P))
0.5-1 µg/mL
Western Blot (WB)
0.1-0.5 µg/mL
Product Specifications
Species Reactivity
Mouse, Rat, Human
Host / Isotype
Rabbit / IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human HMGB2, identical to the related mouse and rat sequences.
Conjugate
Unconjugated
Form
Lyophilized
Purification
Affinity chromatography
Storage buffer
0.2mg sodium phosphate with 5mg BSA, 0.9mg NaCl
Contains
0.05mg sodium azide
Storage conditions
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.

Product Specific Information

Synthetic peptide sequence: 65-97aa, KSDKARYDREMKNYVPPKGDKKGKKKDPNAPKR.

Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.

Target Information

HMGB2 encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Bioinformatics

Protein Aliases: High mobility group protein 2; High mobility group protein B2; high-mobility group (nonhistone chromosomal) protein 2; high-mobility group box 2; HMG-2; HMG2; HMGB2

Gene Aliases: C80539; HMG-2; HMG2; HMGB2

UniProt ID: (Human) P26583, (Rat) P52925, (Mouse) P30681

Entrez Gene ID: (Human) 3148, (Rat) 29395, (Mouse) 97165

Molecular Function: DNA binding protein HMG box transcription factor chromatin/chromatin-binding protein nucleic acid binding signaling molecule transcription factor

Function(s)
positive regulation of endothelial cell proliferation inflammatory response to antigenic stimulus DNA topological change apoptotic DNA fragmentation chromatin organization nucleosome assembly transcription, DNA-templated regulation of transcription from RNA polymerase II promoter spermatid nucleus differentiation male gonad development positive regulation of nuclease activity DNA geometric change response to lipopolysaccharide positive regulation of interferon-beta production V(D)J recombination response to drug positive regulation of DNA binding innate immune response positive regulation of innate immune response positive regulation of erythrocyte differentiation positive regulation of megakaryocyte differentiation negative regulation of transcription, DNA-templated positive regulation of transcription, DNA-templated positive regulation of transcription from RNA polymerase II promoter response to steroid hormone regulation of neurogenesis defense response to Gram-negative bacterium defense response to Gram-positive bacterium positive chemotaxis DNA ligation involved in DNA repair cell chemotaxis cellular response to lipopolysaccharide regulation of stem cell proliferation negative regulation of extrinsic apoptotic signaling pathway via death domain receptors base-excision repair, DNA ligation chromatin remodeling spermatogenesis nervous system development organ regeneration positive regulation of DNA metabolic process
Process(es)
four-way junction DNA binding enhancer sequence-specific DNA binding DNA binding damaged DNA binding double-stranded DNA binding single-stranded DNA binding transcription factor activity, sequence-specific DNA binding protein binding transcription factor binding drug binding DNA binding, bending protein domain specific binding chemoattractant activity transcription regulatory region DNA binding non-sequence-specific DNA binding, bending poly(A) RNA binding RAGE receptor binding supercoiled DNA binding lipid binding nucleosomal histone binding chromatin binding

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support
Display Info:
cookie.CK_ISO_CODE.value:us
cookie.CK_LANG_CODE.value:en
cookie.CK_DISPLAY_TYPE.value:
pageContext.request.scheme:http(not used)
syndicationProtocol:https
syndicationExtensionPrefix:
syndicationDisplayType:

 

page info