Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Cell Analysis
    • Antibodies
    • Mass Spectrometry
    • Cell Culture
    • Laboratory Instruments
    • Clinical and Diagnostics
    • Chromatography
    • Laboratory Equipment
    • Laboratory Supplies
    • Molecular Biology and Nucleic Acid Analysis
    • Sequence-Specific Nucleic Acid Products
    • See all product categories
  • Applications
    • Cell Culture and Transfection
    • Flow Cytometry
    • Cancer Research
    • Chromatography
    • Sequencing
    • PCR
    • Lab Solutions
    • Allergy Diagnostics
    • See all applications and techniques
  • Services
    • Cell Biology Services
    • Custom Services
    • Training Services
    • Lab Informatics Services
    • Financial and Leasing Services
    • Partnering and Licensing Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Food Safety Inspection Services
    • See all services
  • Help and Support
    • How to Order
    • Promotions and Online Offers
    • Contact Us
    • Change Location
    • Create a New Account
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Special Offers
  • Contact Us
  • Quick Order
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Contact Us
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Custom Products & Projects
          • Primary Antibodies ›
          • HO-1 Antibodies

          Invitrogen

          HO-1 Polyclonal Antibody

          Advanced Verification
          13 Published Figures
          11 References
          View all (39) HO-1 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite HO-1 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (1)
          • Published Figures (13)
          • Advanced Verification (1)
          HO-1 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          HO-1 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 15

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          HO-1 Antibody (PA5-77833) in WB

          Western blot was performed using HO-1 Polyclonal Antibody (Product # PA5-77833), and a 32 kDa band corresponding to HO-1 protein was observed across cell lines and tissues tested except MCF-7 which is reported to have low to negative expression. An increase in HO-1 expression was observed in HeLa cells on cobalt chloride treatment. Whole cell extracts (30 µg lysate) of HeLa (Lane 1), HeLa treated with Cobalt Chloride (500 µM for 24 hours) (Lane 2), PANC-1 (Lane 3), MIA PaCa-2 (Lane 4), K-562 (Lane 5), A549 (Lane 6), MCF7 (Lane 7), and tiss... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          HO-1 Antibody in Western Blot (WB)
          HO-1 Antibody in Western Blot (WB)
          HO-1 Antibody in Western Blot (WB)
          HO-1 Antibody in Western Blot, Immunohistochemistry (WB, IHC)
          HO-1 Antibody in Western Blot, Immunohistochemistry (WB, IHC)
          HO-1 Antibody in Western Blot (WB)
          HO-1 Antibody in Western Blot (WB)
          HO-1 Antibody in Western Blot (WB)
          HO-1 Antibody in Western Blot (WB)
          HO-1 Antibody in Western Blot (WB)
          HO-1 Antibody in Western Blot (WB)
          HO-1 Antibody in Western Blot (WB)
          HO-1 Antibody in Western Blot (WB)
          HO-1 Antibody in Western Blot (WB)
          HO-1 Antibody
          HO-1 Polyclonal Antibody

          Product Details

          PA5-77833

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          1:1,000
          View 10 publications 10 publications

          Immunohistochemistry (IHC)

          -
          View 1 publication 1 publication

          Immunohistochemistry (PFA fixed) (IHC (PFA))

          1:100
          -

          Immunocytochemistry (ICC/IF)

          1:100
          -
          Product Specifications

          Species Reactivity

          Dog, Human, Mouse, Rat

          Published species

          Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          Human heme-oxygenase (HO-1) synthetic multiple antigenic peptide (aa. 1-30)1 : MERPQPDSMPQDLSEALKEATKEVHTQAEN
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Liquid

          Concentration

          1 mg/mL

          Amount

          100 µg

          Purification

          Protein A

          Storage buffer

          PBS, pH 7.4, with 50% glycerol

          Contains

          0.09% sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2735912

          Product Specific Information

          1 µg/mL of PA5-77833 was sufficient for detection of HO-1 in 10 µg of heat shocked HeLa cell lysate by colorimetric immunoblot analysis using Goat anti-rabbit IgG:HRP as the secondary antibody.|Detects approximately 32kDa.

          Target Information

          Heme oxygenase (HO) is a microsomal enzyme that catalyzes the oxidation of heme to the antioxidant molecules, biliverdin and carbon monoxide. HO consists of two homologous isozymes, an inducible HO-1 and a constitutively expressed HO-2. HO-1 is induced by a wide variety of stimuli including conditions of oxidative stress, inflammatory agents, transforming growth factor beta and heat shock. The increase in expression of HO-1 is thought to be a cellular defense mechanism against oxidative stress since elevated HO could eventually generate more bilirubin, an anti-oxidant.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          Bioinformatics

          Protein Aliases: heat shock protein, 32-kD; heme orygenase 1; heme oxygenase (decycling) 1; heme oxygenase (decyclizing) 1; Heme oxygenase 1; hemoxygenase; HMOX1; HO-1; HSP32; P32 protein; unnamed protein product

          View more View less

          Gene Aliases: bK286B10; D8Wsu38e; Hemox; Heox; HEOXG; Hmox; HMOX1; HMOX1D; HO; HO-1; HO1; HSP32

          View more View less

          UniProt ID: (Human) P09601, (Rat) P06762, (Mouse) P14901

          View more View less

          Entrez Gene ID: (Human) 3162, (Dog) 442987, (Rat) 24451, (Mouse) 15368

          View more View less

          Function(s)
          heme oxygenase (decyclizing) activity structural molecule activity protein binding oxidoreductase activity enzyme binding heme binding identical protein binding protein homodimerization activity metal ion binding phospholipase D activity signal transducer activity oxygenase
          Process(es)
          angiogenesis endothelial cell proliferation wound healing involved in inflammatory response negative regulation of leukocyte migration regulation of transcription from RNA polymerase II promoter heme oxidation cellular iron ion homeostasis apoptotic process response to oxidative stress smooth muscle hyperplasia macroautophagy positive regulation of macroautophagy negative regulation of macroautophagy positive regulation of chemokine production erythrocyte homeostasis low-density lipoprotein particle clearance cellular response to heat response to nicotine intracellular signal transduction heme catabolic process heme metabolic process response to hydrogen peroxide positive regulation of I-kappaB kinase/NF-kappaB signaling regulation of angiogenesis positive regulation of angiogenesis positive regulation of smooth muscle cell proliferation negative regulation of smooth muscle cell proliferation multicellular organismal iron ion homeostasis cellular response to arsenic-containing substance cellular response to cadmium ion cellular response to cisplatin positive regulation of cell migration involved in sprouting angiogenesis negative regulation of ferroptosis negative regulation of cytokine production involved in inflammatory response negative regulation of extrinsic apoptotic signaling pathway via death domain receptors positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis epithelial cell apoptotic process positive regulation of epithelial cell apoptotic process response to hypoxia phospholipid metabolic process small GTPase mediated signal transduction regulation of blood pressure cell death negative regulation of cell proliferation intrinsic apoptotic signaling pathway in response to DNA damage negative regulation of muscle cell apoptotic process cellular response to nutrient negative regulation of mast cell cytokine production regulation of transcription from RNA polymerase II promoter in response to iron negative regulation of mast cell degranulation negative regulation of DNA binding negative regulation of sequence-specific DNA binding transcription factor activity negative regulation of neuron apoptotic process regulation of transcription from RNA polymerase II promoter in response to oxidative stress response to estrogen regulation of sequence-specific DNA binding transcription factor activity protein homooligomerization iron ion homeostasis cellular response to hypoxia oxidation-reduction process
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          • Social Media
          • Contact Us
          • Report a Site Issue
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Responsibility Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Chile flag icon
          Chile

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-9fm2r:80/100.66.79.29:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline