Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
HO-1 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 13
HO-1 Antibody (PA5-77833) in WB
Western blot was performed using HO-1 Polyclonal Antibody (Product # PA5-77833), and a 32 kDa band corresponding to HO-1 protein was observed across cell lines and tissues tested except MCF-7 which is reported to have low to negative expression. An increase in HO-1 expression was observed in HeLa cells on cobalt chloride treatment. Whole cell extracts (30 µg lysate) of HeLa (Lane 1), HeLa treated with Cobalt Chloride (500 µM for 24 hours) (Lane 2), PANC-1 (Lane 3), MIA PaCa-2 (Lane 4), K-562 (Lane 5), A549 (Lane 6), MCF7 (Lane 7), and tiss... View More
Product Details
PA5-77833
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Dog,
Human,
Mouse,
Rat
Published species
C. elegans,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
Human heme-oxygenase (HO-1) synthetic multiple antigenic peptide (aa. 1-30)1 : MERPQPDSMPQDLSEALKEATKEVHTQAEN
Conjugate
Form
Liquid
Concentration
1 mg/mL
Purification
Protein A
Storage buffer
PBS, pH 7.4, with 50% glycerol
Contains
0.09% sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
1 µg/mL of PA5-77833 was sufficient for detection of HO-1 in 10 µg of heat shocked HeLa cell lysate by colorimetric immunoblot analysis using Goat anti-rabbit IgG:HRP as the secondary antibody.|Detects approximately 32kDa.
Target Information
Heme oxygenase (HO) is a microsomal enzyme that catalyzes the oxidation of heme to the antioxidant molecules, biliverdin and carbon monoxide. HO consists of two homologous isozymes, an inducible HO-1 and a constitutively expressed HO-2. HO-1 is induced by a wide variety of stimuli including conditions of oxidative stress, inflammatory agents, transforming growth factor beta and heat shock. The increase in expression of HO-1 is thought to be a cellular defense mechanism against oxidative stress since elevated HO could eventually generate more bilirubin, an anti-oxidant.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Bioinformatics
Protein Aliases: heat shock protein, 32-kD; heme orygenase 1; heme oxygenase (decycling) 1; heme oxygenase (decyclizing) 1; Heme oxygenase 1; hemoxygenase; HO-1; HSP32; P32 protein
Gene Aliases: bK286B10; D8Wsu38e; Hemox; Heox; HEOXG; Hmox; HMOX1; HMOX1D; HO; HO-1; HO1; HSP32
UniProt ID: (Human) P09601, (Rat) P06762, (Mouse) P14901
Entrez Gene ID: (Human) 3162, (Dog) 442987, (Rat) 24451, (Mouse) 15368
angiogenesis
endothelial cell proliferation
wound healing involved in inflammatory response
negative regulation of leukocyte migration
heme oxidation
cellular iron ion homeostasis
response to oxidative stress
small GTPase mediated signal transduction
excretion
regulation of blood pressure
cell death
intrinsic apoptotic signaling pathway in response to DNA damage
negative regulation of muscle cell apoptotic process
smooth muscle hyperplasia
cellular response to nutrient
negative regulation of mast cell cytokine production
erythrocyte homeostasis
low-density lipoprotein particle clearance
regulation of transcription from RNA polymerase II promoter in response to iron
cellular response to heat
response to nicotine
intracellular signal transduction
heme catabolic process
response to hydrogen peroxide
positive regulation of I-kappaB kinase/NF-kappaB signaling
negative regulation of mast cell degranulation
negative regulation of DNA binding
negative regulation of sequence-specific DNA binding transcription factor activity
negative regulation of neuron apoptotic process
regulation of transcription from RNA polymerase II promoter in response to oxidative stress
response to estrogen
positive regulation of chemokine biosynthetic process
regulation of angiogenesis
positive regulation of angiogenesis
positive regulation of vasodilation
positive regulation of smooth muscle cell proliferation
negative regulation of smooth muscle cell proliferation
regulation of sequence-specific DNA binding transcription factor activity
protein homooligomerization
iron ion homeostasis
cellular response to arsenic-containing substance
cellular response to cadmium ion
cellular response to hypoxia
negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
response to hypoxia
phospholipid metabolic process
negative regulation of cell proliferation
heme metabolic process
apoptotic process
oxidation-reduction process
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support