Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
HPa1 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
PA5-79393
Product Specifications
Species Reactivity
Human,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Heparanase 1 (301-331aa NGRTATKEDFLNPDVLDIFISSVQKVFQVVE).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: Rat Liver Tissue, Human Placenta Tissue, A549 whole cell.
Target Information
Stem cells offer a therapeutic promise for many diseases. In the case of diabetes, stem cells offer the promise that beta cells may be generated ex vivo for the possible transplantation and cure of Type I diabetes (Couri CE, et al. ). For this to happen, stem cells will need to be isolated and expanded, they will need to be differentiated toward the beta cell lineage, and the differentiated cell progeny used for transplantation may need to be isolated from complex cell mixtures following differentiation. Appropriate markers targeting cell surface molecules on developing and mature pancreatic cells will be required for such research.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Endo-glucoronidase; Heparanase; Heparanase-1; heparanase-like; Hpa1
Gene Aliases: HEP; HPA; HPA1; HPR1; HPSE; HPSE1; HSE1
UniProt ID: (Human) Q9Y251, (Rat) Q71RP1
Entrez Gene ID: (Human) 10855, (Rat) 64537
carbohydrate metabolic process
glycosaminoglycan catabolic process
proteoglycan metabolic process
cell-matrix adhesion
positive regulation of vascular endothelial growth factor production
positive regulation of blood coagulation
extracellular matrix organization
heparan sulfate proteoglycan catabolic process
positive regulation of osteoblast proliferation
regulation of hair follicle development
positive regulation of hair follicle development
positive regulation of protein kinase B signaling
angiogenesis involved in wound healing
vascular wound healing
cell adhesion
wound healing
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support