Hamburger Menu Button
Thermo Fisher Scientific Logo
登入
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Tubes
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO 和 CRO 服務
    • CDMO 服務
    • 臨床試驗 CRO 服務
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • Register for an Account
    • How to Order
    • Instrument Support
    • Technical Support Centers
    • Learning Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • 快速訂購
          • 登入
            登入
            Don't have an account ? Create Account
            • 帳戶
            • 訂單
            • 訂製產品與專案
          • Primary Antibodies ›
          • HSPA9 Antibodies

          Invitrogen

          HSPA9 Polyclonal Antibody

          Advanced Verification
          View all (28) HSPA9 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite HSPA9 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (9)
          • Advanced Verification (1)
          HSPA9 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          HSPA9 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 10

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          HSPA9 Antibody (PA5-79410) in ICC/IF

          Immunofluorescence analysis of HSPA9 was performed using 70% confluent log phase HeLa cells. The cells were fixed with 4% paraformaldehyde for 10 minutes, permeabilized with 0.1% Triton™ X-100 for 15 minutes, and blocked with 2% BSA for 1 hour at room temperature. The cells were labeled with HSPA9 Polyclonal Antibody (Product # PA5-79410) at 5 µg/mL concentration in 0.1% BSA, incubated at 4 degree Celsius overnight and then with Goat anti-Rabbit IgG (Heavy Chain), Superclonal™ Recombinant Secondary Antibody, Alexa Fluor 488 conjugate (Prod... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          HSPA9 Antibody in Immunocytochemistry (ICC/IF)
          HSPA9 Antibody in Immunocytochemistry (ICC/IF)
          HSPA9 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          HSPA9 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          HSPA9 Antibody in Western Blot (WB)
          HSPA9 Antibody in Western Blot (WB)
          HSPA9 Antibody in Western Blot (WB)
          HSPA9 Antibody in Western Blot (WB)
          HSPA9 Antibody in Flow Cytometry (Flow)
          HSPA9 Antibody
          HSPA9 Polyclonal Antibody

          Product Details

          PA5-79410

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          2-5 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          5 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -

          Immunoprecipitation (IP)

          0.5-2 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Non-human primate, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human Grp75 (646-679aa KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          0.01mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746526

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human Hela whole cell, human A549 whole cell, human Jurkat whole cell, human HepG2 whole cell, rat testis tissue, rat PC-12 whole cell, mouse testis tissue, mouse NIH/3T3 whole cell. IHC: human lung cancer tissue, human intestinal cancer tissue. ICC/IF: A549 cell. Flow: HL-60 cell IP: HepG2 cell.

          Target Information

          The HSP70 family is composed of four highly conserved proteins: HSP70, HSC70, GRP75 and GRP78. These proteins serve a variety of roles. GRP75 expression is restricted to the mitochondrial matrix and aids in the translocation and folding of nascent polypeptide chains of both nuclear and mitochondrial origin. GRP75 and GRP78 are unresponsive to heat stress and are induced by glucose deprivation.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: 75 kDa glucose-regulated protein; C3H-specific antigen; catecholamine-regulated protein 40; CRP40; epididymis secretory sperm binding protein Li 124m; GRP 75; GRP-75; Heat shock 70 kDa protein 9; heat shock 70kD protein 9B; heat shock 70kDa protein 9 (mortalin); heat shock 70kDa protein 9A; Heat shock protein; heat shock protein 9A; heat shock protein cognate 74; Heat shock protein family A member 9; heat shock protein, 74 kDa, A; heat shock protein, A; HSP; MGC4500; Mortalin; mortalin, perinuclear; mortalin-2; mortalin2; MOT; mtHSP70; p66 MOT; p66-mortalin; PBP74; Peptide-binding protein 74; Stress-70 protein, mitochondrial; unnamed protein product

          View more View less

          Gene Aliases: 74kDa; CRP40; CSA; EVPLS; GRP-75; GRP75; HEL-S-124m; Hsc74; Hsp74; Hsp74a; HSPA9; Hspa9a; HSPA9B; Mortalin; MOT; Mot-2; MOT2; mt-HSP70; Mthsp70; MTHSP75; PBP74; SAAN; SIDBA4

          View more View less

          UniProt ID: (Human) P38646, (Rat) P48721, (Mouse) P38647

          View more View less

          Entrez Gene ID: (Human) 3313, (Rat) 291671, (Mouse) 15526

          View more View less

          Function(s)
          nucleotide binding RNA binding protein binding ATP binding hydrolase activity ATPase activity enzyme binding heat shock protein binding ubiquitin protein ligase binding protein binding involved in protein folding unfolded protein binding ATP-dependent protein folding chaperone fibroblast growth factor binding poly(A) RNA binding
          Process(es)
          protein folding protein export from nucleus response to toxic substance cellular response to interleukin-1 intracellular protein transport inner mitochondrial membrane organization iron-sulfur cluster assembly erythrocyte differentiation calcium ion transmembrane import into mitochondrion protein refolding positive regulation of apoptotic process negative regulation of apoptotic process regulation of erythrocyte differentiation negative regulation of erythrocyte differentiation negative regulation of hematopoietic stem cell differentiation negative regulation of hemopoiesis
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-8dsbr:80/100.66.76.150:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline