Search

  • Statut des commandes
  • Commande rapide
  • Promos

Invitrogen

HTR2A Polyclonal Antibody

1 Published Figure
2 References
View all (19) HTR2A antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Additional Information:
{{banner.description}}
{{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
HTR2A Polyclonal Antibody

Product Details

PA5-95288

Applications
Tested Dilution
Publications

Western Blot (WB)

0.1-0.5 µg/mL
-

Immunohistochemistry (IHC)

-
View 1 publication 1 publication

Immunohistochemistry (Paraffin) (IHC (P))

0.5-1 µg/mL
View 1 publication 1 publication
Product Specifications

Species Reactivity

Human, Rat

Published species

Rat

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human 5HT2A Receptor (400-431aa KENKKPLQLILVNTIPALAYKSSQLQMGQKKN) .
3D Epitope / Immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Amount

100 µg

Purification

Affinity chromatography

Storage buffer

4mg trehalose, 0.9mg NaCl, 0.2mg Na2PO4

Contains

no preservative

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_2807092

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - WB: Rat Brain Tissue, Rat Testis Tissue, U87 whole cell. IHC: human glioma tissue, rat brain tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Target Information

In platelets and gut, serotonin plays a major role in cardiovascular function and motility of the gastrointestinal tract, respectively. Serotonin mediates its effects through several of G protein coupled receptors, designated 5-HT receptors or alternatively SR receptors. The SR-2 receptors are comprised of three subtypes, SR-2A, SR-2B and SR-2C, which activate phospholipase C and release intracellular stores of calcium in response to serotonin. SR-2A has a specific role in tracheal smooth muscle contraction, bronchoconstriction and mediating aldosterone production, and it is also thought to play a role in several psychiatric disorders, including depression and schizophrenia. SR-2B is expressed in embryonic and adult cardiovascular tissues, gut and brain and plays an important role in the pathology of cardiac disorders. SR-2C is thought to mediate the effects of atypical antipsychotic drugs.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Bioinformatics

Protein Aliases: 5-HT-2; 5-HT-2A; 5-HT2 receptor; 5-HT2A/2C; 5-HT2A/2C receptor; 5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled; 5-hydroxytryptamine receptor 2A; 5HT2A Receptor; serotonin 5-HT-2A receptor; serotonin 5HT-2 receptor; serotonin receptor; Serotonin receptor 2A; SR2A; unnamed protein product

View more View less

Gene Aliases: 5-HT2A; 5Ht-2; HTR2; HTR2A

View more View less

UniProt ID: (Human) P28223, (Rat) P14842

View more View less

Entrez Gene ID: (Human) 3356, (Rat) 29595

View more View less

Function(s)
Gq/11-coupled serotonin receptor activity virus receptor activity G-protein coupled receptor activity G-protein coupled serotonin receptor activity protein binding protein tyrosine kinase activator activity neurotransmitter receptor activity identical protein binding macromolecular complex binding serotonin binding 1-(4-iodo-2,5-dimethoxyphenyl)propan-2-amine binding serotonin receptor activity G-protein alpha-subunit binding drug binding protein complex binding G-protein coupled receptor
Process(es)
temperature homeostasis positive regulation of cytokine production involved in immune response glycolytic process cellular calcium ion homeostasis signal transduction G-protein coupled receptor signaling pathway G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger positive regulation of cytosolic calcium ion concentration phospholipase C-activating serotonin receptor signaling pathway serotonin receptor signaling pathway chemical synaptic transmission memory positive regulation of cell proliferation response to xenobiotic stimulus positive regulation of phosphatidylinositol biosynthetic process regulation of dopamine secretion artery smooth muscle contraction urinary bladder smooth muscle contraction positive regulation of heat generation response to cocaine negative regulation of potassium ion transport positive regulation of neuron apoptotic process protein localization to cytoskeleton positive regulation of fat cell differentiation positive regulation of glycolytic process positive regulation of vasoconstriction viral entry into host cell sensitization behavioral response to cocaine positive regulation of inflammatory response sensory perception of temperature stimulus detection of temperature stimulus involved in sensory perception of pain detection of mechanical stimulus involved in sensory perception of pain release of sequestered calcium ion into cytosol negative regulation of synaptic transmission, glutamatergic positive regulation of ERK1 and ERK2 cascade G protein-coupled serotonin receptor signaling pathway presynaptic modulation of chemical synaptic transmission positive regulation of execution phase of apoptosis positive regulation of platelet aggregation positive regulation of DNA biosynthetic process activation of phospholipase C activity aging cell death phosphatidylinositol 3-kinase signaling sensory perception of pain sleep positive regulation of kinase activity response to drug positive regulation of MAP kinase activity regulation of hormone secretion positive regulation of peptidyl-tyrosine phosphorylation regulation of behavior
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support