Hamburger Menu Button
Thermo Fisher Scientific Logo
登入
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Tubes
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO 和 CRO 服務
    • CDMO 服務
    • 臨床試驗 CRO 服務
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • Register for an Account
    • How to Order
    • Instrument Support
    • Technical Support Centers
    • Learning Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • 快速訂購
          • 登入
            登入
            Don't have an account ? Create Account
            • 帳戶
            • 訂單
            • 訂製產品與專案
          • Primary Antibodies ›
          • IGFBP5 Antibodies

          Invitrogen

          IGFBP5 Polyclonal Antibody

          View all (13) IGFBP5 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite IGFBP5 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (1)
          IGFBP5 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          IGFBP5 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 1

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          IGFBP5 Antibody (PA5-79454) in WB

          Western blot analysis of IGFBP5 in Lane 1: U20S whole cell lysate, Lane 2: HeLa whole cell lysate using 40 µg per well. Sample was incubated with IGFBP5 (Product # PA5-79454) at a dilution of 0.5 µg/mL. {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          IGFBP5 Antibody in Western Blot (WB)
          IGFBP5 Polyclonal Antibody

          Product Details

          PA5-79454

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          ELISA (ELISA)

          0.1-0.5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of human IGFBP5 (76-114aa QGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIER).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746570

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: U20S whole cell, HELA whole cell.

          Target Information

          The insulin-like growth factor-binding proteins, or IGFBPs, are a family of homologous proteins that have co-evolved with the IGFs. They serve not only as shuttle molecules for the soluble IGFs, but also confer a level of regulation to the IGF signaling system. Physical association of the IGFBPs with IGF influences the bio-availability of the growth factors, as well as their concentration and distribution in the extracellular environment. In addition, the IGFBPs appear to have biological activity independent of the IGFs. Seven IGFBPs have thus far been described, each differing in their tissue distribution, half-lives and modulation of IGF interactions with their receptors. For instance, IGFBP1 is negatively regulated by insulin production. The IGFBP1 gene is expressed at a high level during fetal liver development and in response to nutritional changes and diabetes. It has been suggested that IGFBP2 functions as chaperone, escorting IGFs to their target tissues. It is expressed in several human tissues including fetal eye and fetal brain. IGFBP3 is the most abundant IGFBP and is complexed with roughly 80% of the serum IGFs. Both IGFBP3 and IGFBP4 are released by dermal fibroblasts in response to incision injury. IGFBP5 is secreted by myoblasts and may play a key role in muscle differentiation.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: IBP 5; IBP-5; IGF BP5; IGF-binding protein 5; IGFBP; IGFBP 5; IGFBP-5; IGFBP5; Insulin like growth factor binding protein; Insulin-like growth factor-binding protein 5; unnamed protein product

          View more View less

          Gene Aliases: IBP5; IGFBP5

          View more View less

          UniProt ID: (Human) P24593

          View more View less

          Entrez Gene ID: (Human) 3488

          View more View less

          Function(s)
          fibronectin binding protein binding insulin-like growth factor binding growth factor binding insulin-like growth factor I binding insulin-like growth factor II binding receptor agonist activity
          Process(es)
          regulation of cell growth osteoblast differentiation signal transduction female pregnancy cell proliferation negative regulation of smooth muscle cell migration negative regulation of translation negative regulation of cell migration hair follicle morphogenesis intracellular signal transduction regulation of growth glucose homeostasis regulation of insulin-like growth factor receptor signaling pathway positive regulation of insulin-like growth factor receptor signaling pathway negative regulation of insulin-like growth factor receptor signaling pathway type B pancreatic cell proliferation negative regulation of osteoblast differentiation negative regulation of growth insulin-like growth factor receptor signaling pathway lung alveolus development negative regulation of smooth muscle cell proliferation striated muscle cell differentiation positive regulation of protein kinase B signaling mammary gland involution response to growth hormone cellular response to cAMP negative regulation of muscle tissue development negative regulation of skeletal muscle hypertrophy positive regulation of vascular smooth muscle cell proliferation positive regulation of vascular associated smooth muscle cell migration
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-pgj68:80/100.66.79.163:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline