Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Cell Analysis
    • Antibodies
    • Mass Spectrometry
    • Cell Culture
    • Laboratory Instruments
    • Clinical and Diagnostics
    • Chromatography
    • Laboratory Equipment
    • Laboratory Supplies
    • Molecular Biology and Nucleic Acid Analysis
    • Sequence-Specific Nucleic Acid Products
    • See all product categories
  • Applications
    • Cell Culture and Transfection
    • Flow Cytometry
    • Cancer Research
    • Chromatography
    • Sequencing
    • PCR
    • Lab Solutions
    • Allergy Diagnostics
    • See all applications and techniques
  • Services
    • Cell Biology Services
    • Custom Services
    • Training Services
    • Lab Informatics Services
    • Financial and Leasing Services
    • Partnering and Licensing Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Food Safety Inspection Services
    • See all services
  • Help and Support
    • How to Order
    • Promotions and Online Offers
    • Contact Us
    • Change Location
    • Create a New Account
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Special Offers
  • Contact Us
  • Quick Order
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Contact Us
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Custom Products & Projects
          • Primary Antibodies ›
          • IKAROS Antibodies

          Invitrogen

          IKAROS Polyclonal Antibody

          View all (22) IKAROS antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite IKAROS Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (7)
          IKAROS Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          IKAROS Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 7

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          IKAROS Antibody (PA5-95293) in ICC/IF

          Immunocytochemistry analysis of Ikaros using anti-Ikaros2 antibody (Product # PA5-95293) . Ikaros was detected in a section of MCF-7 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 5μg/mL rabbit anti-Ikaros antibody (Product # PA5-95293) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with D... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          IKAROS Antibody in Immunocytochemistry (ICC/IF)
          IKAROS Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          IKAROS Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          IKAROS Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          IKAROS Antibody in Western Blot (WB)
          IKAROS Antibody in Flow Cytometry (Flow)
          IKAROS Antibody in Flow Cytometry (Flow)
          IKAROS Polyclonal Antibody

          Product Details

          PA5-95293

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          5 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human Ikaros (428-459aa LKEEHRAYDLLRAASENSQDALRVVSTSGEQM).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807097

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human Daudi whole cell. IHC: mouse spleen tissue, rat spleen tissue, human tonsil tissue. ICC/IF: MCF-7 cell. Flow: U937 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          DNA-binding protein IKAROS functions in the specification and the maturation of the T lymphocyte. It also interacts with a critical control element in the terminal deoxynucleotidyl transferase promoter as well as with the promoters for other genes expressed during early stages of B-cell and T-cell development.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: CLL-associated antigen KW-6; DNA-binding protein Ikaros; hIk-1; Ikaros family zinc finger protein 1; Ikaros zinc finger protein; zinc finger protein subfamily 1A 1; DNA-binding protein Ikaros; CLL-associated antigen KW-6; Ikaros family zinc finger protein 1; lymphoid transcription factor LyF-1; lymphocyte-restricted zinc finger DNA binding protein; Lymphoid transcription factor LyF-1; predicted protein of HQ0758; protein phosphatase 1, regulatory subunit 92; unnamed protein product; zinc finger protein, subfamily 1A, 1 (Ikaros); zinc finger transcription factor

          View more View less

          Gene Aliases: 5832432G11Rik; CVID13; hlk-1; Hs.54452; IK1; IKAROS; IKZF1; LyF-1; LYF1; mKIAA4227; PPP1R92; PRO0758; RGD1562979; Zfpn1a1; ZNFN1A1

          View more View less

          UniProt ID: (Human) Q13422

          View more View less

          Entrez Gene ID: (Human) 10320, (Mouse) 22778, (Rat) 305501

          View more View less

          Function(s)
          RNA polymerase II core promoter proximal region sequence-specific DNA binding DNA binding transcription factor activity, sequence-specific DNA binding protein binding zinc ion binding protein domain specific binding identical protein binding metal ion binding RNA polymerase II regulatory region sequence-specific DNA binding transcriptional repressor activity, RNA polymerase II transcription regulatory region sequence-specific binding sequence-specific DNA binding transcription regulatory region DNA binding protein heterodimerization activity C2H2 zinc finger transcription factor
          Process(es)
          chromatin organization regulation of transcription from RNA polymerase II promoter mesoderm development lymphocyte differentiation erythrocyte differentiation negative regulation of transcription, DNA-templated negative regulation of transcription from RNA polymerase II promoter natural killer cell differentiation regulation of transcription, DNA-templated transcription from RNA polymerase II promoter hemopoiesis B cell differentiation T cell differentiation forebrain development positive regulation of multicellular organism growth positive regulation of B cell differentiation positive regulation of neutrophil differentiation positive regulation of transcription, DNA-templated positive regulation of transcription from RNA polymerase II promoter lymph node development thymus development Peyer's patch development gland development positive regulation of NK T cell differentiation retina development in camera-type eye
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          • Social Media
          • Contact Us
          • Report a Site Issue
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Responsibility Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Chile flag icon
          Chile

          Your items have has been added!


          Host server : magellan-search-blue-744bc48644-fvx7n:80/100.66.78.247:80.
          git-commit: 747bde55a712f6f97bf7760408d445eefba4e16f
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.48.0-Offline