Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Western Blot Products
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Food and Beverage
    • Lab Solutions
    • Pharma and Biopharma
    • Real-Time PCR
    • Semiconductor Analysis
    • Clinical and Diagnostics
    • Digital Solutions
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • See all services
  • Help and Support
    • Order Help
    • Digital Solutions
    • Product Support
    • Technical Information
    • Training and Education
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Special Offers
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Custom Products & Projects
            • Instrument Management

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • IRF2 Antibodies

          Invitrogen

          IRF2 Polyclonal Antibody

          View all (21) IRF2 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Protocols
          Questions & Answers
          Tech Support

          Cite IRF2 Polyclonal Antibody

          • Antibody Testing Data (3)
          IRF2 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          IRF2 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 3

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          IRF2 Antibody (PA5-79516) in WB

          Western blot was performed using Anti-IRF2 Polyclonal Antibody (Product # PA5-79516) and a 45kDa band corresponding to Interferon regulatory factor 2 was observed across all the tested cell lines and tissues, except Mouse Skeletal muscle. Nuclear enriched extracts (40 µg lysate) of MCF7 (Fig. A, Lane 1), Jurkat (Fig. A, Lane 2), HT-29 (Fig. A, Lane 3), Raji (Fig. A, Lane 4), HeLa (Fig. A, Lane 5), Mouse Colon (Fig. B, Lane 1), Mouse Spleen (Fig. B, Lane 2), Mouse Skeletal Muscle (Fig. B, Lane 3), Rat Colon (Fig. B, Lane 4) were electrophor... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          IRF2 Antibody in Western Blot (WB)
          IRF2 Antibody in Western Blot (WB)
          IRF2 Antibody in Western Blot (WB)
          IRF2 Polyclonal Antibody

          Product Details

          PA5-79516

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human IRF2 (317-348aa MTPASSSSRPDRETRASVIKKTSDITQARVKS).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746632

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: Rat Intestine Tissue, SW620 whole cell, COLO320 whole cell, HELA whole cell, A549 whole cell.

          Target Information

          IRF2 belongs to the interferon regulatory factor family. IRF2 regulates the transcription regulation important to cell proliferation as well as immune responses by binding to the upstream regulatory region of type I IFN and IFNinducible MHC class I genes (the interferon consensus sequence (ICS)) and repression of those genes. However, IRF2 also functions as a transcriptional activator of histone H4 by interactions with NF-kappa B.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: DKFZp686F0244; Interferon regulatory factor 2; IRF-2; OTTHUMP00000218576; OTTHUMP00000218580

          View more View less

          Gene Aliases: IRF-2; IRF2

          View more View less

          UniProt ID: (Human) P14316

          View more View less

          Entrez Gene ID: (Human) 3660, (Rat) 290749

          View more View less

          Function(s)
          RNA polymerase II regulatory region sequence-specific DNA binding transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding DNA binding transcription factor activity, sequence-specific DNA binding protein binding regulatory region DNA binding winged helix/forkhead transcription factor
          Process(es)
          negative regulation of transcription from RNA polymerase II promoter regulation of transcription, DNA-templated transcription from RNA polymerase II promoter blood coagulation cell proliferation positive regulation of transcription from RNA polymerase II promoter interferon-gamma-mediated signaling pathway type I interferon signaling pathway transcription, DNA-templated
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Taiwan flag icon
          Taiwan

          Your items have has been added!


          Host server : magellan-search-green-55658555d6-vw5lf:80/100.66.79.224:80.
          git-commit: ec8e7df5f8fec8d765bd419205f1b5046a016d37
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.41.0-Offline