Search
Search
Invitrogen
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
The synthetic peptide sequence is 575-617aa, FRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAE
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
ITK is a tyrosine kinase expressed in T-cells which contains both SH2 and SH3 domains. ITK is thought to play a role in T-cell proliferation and differentiation. The Tec family of non-receptor tyrosine kinases is composed of six proteins designated Tec, Itk (also known as Emt or Tsk), Btk (previously known as Atk, BPK or Emb), Bmx, Txk (also known as Rlk) and Dsrc28C. All members of the family contain SH3 and SH2 domains and, with the exception of Txk and Dsrc28C, also contain pleckstrin homology (PH) and Tec homology (TH) domains in their amino termini. Itk associates with CD28 and becomes activated subsequent to CD28 ligation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support