Search

  • 訂單查詢
  • 快速訂購

Alomone Labs, LTD

KCNH2 (HERG) Polyclonal Antibody

View all (14) KCNH2 antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Additional Information:
{{banner.description}}
{{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
KCNH2 (HERG) Polyclonal Antibody

Product Details

APC-062-200UL

Applications
Tested Dilution
Publications

Western Blot (WB)

1:400
-

Immunocytochemistry (ICC/IF)

Assay-dependent
-

Immunoprecipitation (IP)

Assay-dependent
-
Product Specifications

Species Reactivity

Human, Mouse, Rat

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

GST fusion protein with the sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of humanKV11.1 (HERG), Intracellular, C-terminus
3D Epitope / Immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

0.6 mg/mL

Amount

120 µg

Purification

Antigen affinity chromatography

Storage buffer

PBS, pH 7.4, with 1% BSA

Contains

0.05% sodium azide

Storage conditions

-20°C, Avoid Freeze/Thaw Cycles

Shipping conditions

Ambient (domestic); Wet ice (international)

Product Specific Information

Reconstitution: 25 µL, 50 µL or 0.2 mL double distilled water (DDW), depending on the sample size. The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20C. The reconstituted solution can be stored at 4C for up to 1 week. For longer periods, small aliquots should be stored at -20C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Target Information

Human ether-a-go-go related gene (HERG) encodes the pore-forming alpha subunit of the delayed rectifier potassium channel IKr. There are two N-terminal splice variants of HERG include the full-length isoform 1 alpha and the shorter isoform 1 beta. Isoform 1 beta lacks the PAS motif and deactivates at a faster rate than isoform 1alpha. Residues within the C-terminal play a role in channel expression and channel gating, including voltage-dependent activation. HERG is expressed in the heart and is more abundantly expressed in the ventricles than in the atria. Mutations in the gene encoding HERG increase beat-to-beat variability and early after depolarization. These fluctuations facilitate the genesis and propagation of premature heartbeats associated with inheritable long QT syndrome type 2 and short QT syndrome type 1.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: Eag homolog; eag-related protein 1; ERG-1; Ether-a-go-go-related gene potassium channel 1; ether-a-go-go-related potassium channel protein; ether-a-go-go-related protein 1; HERG-1; human ether-a-go-go-related; long QT syndrome type 2; M-erg1; potassium channel, voltage gated eag related subfamily H, member 2; Potassium voltage-gated channel subfamily H member 2; potassium voltage-gated channel, subfamily H (eag-related), member 2; r-ERG; RERG; subfamily H; eag-related; Voltage-gated inwardly rectifying potassium channel KCNH2; Voltage-gated potassium channel subunit Kv11.1

View more View less

Gene Aliases: AI326795; ERG; ERG-1; ERG1; H-ERG; HERG; HERG1; KCNH2; Kv11.1; LQT; LQT2; M-erg; Merg1; merg1a; merg1b; SQT1

View more View less

UniProt ID: (Human) Q12809, (Mouse) O35219, (Rat) O08962

View more View less

Entrez Gene ID: (Human) 3757, (Mouse) 16511, (Rat) 117018

View more View less

Function(s)
transcription regulatory region sequence-specific DNA binding ion channel activity inward rectifier potassium channel activity voltage-gated potassium channel activity delayed rectifier potassium channel activity potassium channel activity protein binding ubiquitin protein ligase binding identical protein binding protein homodimerization activity scaffold protein binding voltage-gated potassium channel activity involved in ventricular cardiac muscle cell action potential repolarization phosphorelay sensor kinase activity signal transducer activity voltage-gated ion channel activity C3HC4-type RING finger domain binding voltage-gated potassium channel activity involved in cardiac muscle cell action potential repolarization ion channel
Process(es)
regulation of heart rate by hormone ion transport potassium ion transport ion transmembrane transport regulation of membrane potential positive regulation of transcription, DNA-templated potassium ion homeostasis transmembrane transport cardiac muscle contraction regulation of membrane repolarization regulation of ventricular cardiac muscle cell membrane repolarization cellular response to xenobiotic stimulus potassium ion transmembrane transport ventricular cardiac muscle cell action potential membrane repolarization membrane depolarization during action potential membrane repolarization during action potential membrane repolarization during cardiac muscle cell action potential regulation of heart rate by cardiac conduction potassium ion export across plasma membrane cation transmembrane transport membrane repolarization during ventricular cardiac muscle cell action potential regulation of potassium ion transmembrane transport negative regulation of potassium ion transmembrane transport positive regulation of potassium ion transmembrane transport negative regulation of potassium ion export across plasma membrane potassium ion import across plasma membrane phosphorelay signal transduction system transport signal transduction regulation of ion transmembrane transport cellular response to drug protein heterooligomerization potassium ion export negative regulation of potassium ion export brain development spinal cord development signal transduction by protein phosphorylation
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support