Hamburger Menu Button
Thermo Fisher Scientific Logo
登入
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Tubes
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO 和 CRO 服務
    • CDMO 服務
    • 臨床試驗 CRO 服務
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • Register for an Account
    • How to Order
    • Instrument Support
    • Technical Support Centers
    • Learning Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • 快速訂購
          • 登入
            登入
            Don't have an account ? Create Account
            • 帳戶
            • 訂單
            • 訂製產品與專案
          • Primary Antibodies ›
          • KCNH2 Antibodies

          Alomone Labs, LTD

          KCNH2 (HERG) Polyclonal Antibody

          View all (12) KCNH2 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite KCNH2 (HERG) Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (3)
          KCNH2 (HERG) Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          KCNH2 (HERG) Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 3

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          KCNH2 (HERG) Antibody (APC-062-200UL) in ICC/IF

          Expression of KV11.1 (HERG) in HEK-293 transfectedcells - Immunocytochemical staining of fixed and permeabilized KV11.1 transfectedHEK-293 cells. Cells were stained with Anti-KCNH2 (HERG) Antibody (#APC-062), followed bygoat Anti-rabbit-AlexaFluor-555 secondary Antibody (Red). Almost all transfected cells are stained positive for the KV11.1. Arrows indicate cells that do not expressthe channel. {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          KCNH2 (HERG) Antibody in Immunocytochemistry (ICC/IF)
          KCNH2 (HERG) Antibody in Western Blot (WB)
          KCNH2 (HERG) Antibody in Immunoprecipitation (IP)
          KCNH2 (HERG) Polyclonal Antibody

          Product Details

          APC-062-200UL

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          1:400
          -

          Immunocytochemistry (ICC/IF)

          Assay-dependent
          -

          Immunoprecipitation (IP)

          Assay-dependent
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          GST fusion protein with the sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of humanKV11.1 (HERG), Intracellular, C-terminus
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          0.6 mg/mL

          Amount

          120 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS, pH 7.4, with 1% BSA

          Contains

          0.05% sodium azide

          Storage conditions

          -20°C, Avoid Freeze/Thaw Cycles

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          Product Specific Information

          Reconstitution: 25 µL, 50 µL or 0.2 mL double distilled water (DDW), depending on the sample size. The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20C. The reconstituted solution can be stored at 4C for up to 1 week. For longer periods, small aliquots should be stored at -20C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

          Target Information

          Human ether-a-go-go related gene (HERG) encodes the pore-forming alpha subunit of the delayed rectifier potassium channel IKr. There are two N-terminal splice variants of HERG include the full-length isoform 1 alpha and the shorter isoform 1 beta. Isoform 1 beta lacks the PAS motif and deactivates at a faster rate than isoform 1alpha. Residues within the C-terminal play a role in channel expression and channel gating, including voltage-dependent activation. HERG is expressed in the heart and is more abundantly expressed in the ventricles than in the atria. Mutations in the gene encoding HERG increase beat-to-beat variability and early after depolarization. These fluctuations facilitate the genesis and propagation of premature heartbeats associated with inheritable long QT syndrome type 2 and short QT syndrome type 1.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: Eag homolog; eag-related protein 1; ERG-1; Ether-a-go-go-related gene potassium channel 1; ether-a-go-go-related potassium channel protein; ether-a-go-go-related protein 1; HERG-1; human ether-a-go-go-related; long QT syndrome type 2; M-erg1; potassium channel, voltage gated eag related subfamily H, member 2; Potassium voltage-gated channel subfamily H member 2; potassium voltage-gated channel, subfamily H (eag-related), member 2; r-ERG; RERG; subfamily H; eag-related; Voltage-gated inwardly rectifying potassium channel KCNH2; Voltage-gated potassium channel subunit Kv11.1

          View more View less

          Gene Aliases: AI326795; ERG; ERG-1; ERG1; H-ERG; HERG; HERG1; KCNH2; Kv11.1; LQT; LQT2; M-erg; Merg1; merg1a; merg1b; SQT1

          View more View less

          UniProt ID: (Human) Q12809, (Mouse) O35219, (Rat) O08962

          View more View less

          Entrez Gene ID: (Human) 3757, (Mouse) 16511, (Rat) 117018

          View more View less

          Function(s)
          transcription regulatory region sequence-specific DNA binding ion channel activity inward rectifier potassium channel activity voltage-gated potassium channel activity delayed rectifier potassium channel activity potassium channel activity protein binding ubiquitin protein ligase binding identical protein binding protein homodimerization activity scaffold protein binding voltage-gated potassium channel activity involved in ventricular cardiac muscle cell action potential repolarization phosphorelay sensor kinase activity signal transducer activity voltage-gated ion channel activity C3HC4-type RING finger domain binding voltage-gated potassium channel activity involved in cardiac muscle cell action potential repolarization ion channel
          Process(es)
          regulation of heart rate by hormone ion transport potassium ion transport ion transmembrane transport regulation of membrane potential positive regulation of transcription, DNA-templated potassium ion homeostasis transmembrane transport cardiac muscle contraction regulation of membrane repolarization regulation of ventricular cardiac muscle cell membrane repolarization cellular response to xenobiotic stimulus potassium ion transmembrane transport ventricular cardiac muscle cell action potential membrane repolarization membrane depolarization during action potential membrane repolarization during action potential membrane repolarization during cardiac muscle cell action potential regulation of heart rate by cardiac conduction potassium ion export across plasma membrane cation transmembrane transport membrane repolarization during ventricular cardiac muscle cell action potential regulation of potassium ion transmembrane transport negative regulation of potassium ion transmembrane transport positive regulation of potassium ion transmembrane transport negative regulation of potassium ion export across plasma membrane potassium ion import across plasma membrane phosphorelay signal transduction system transport signal transduction regulation of ion transmembrane transport cellular response to drug protein heterooligomerization potassium ion export negative regulation of potassium ion export brain development spinal cord development signal transduction by protein phosphorylation
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-green-6b469b8bb7-vvsgg:80/100.66.72.198:80.
          git-commit: a334af76dff23450325448aedefe62379591458a
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.48.1-2026.04.16-1.0