Invitrogen

KDM5B Polyclonal Antibody

View all (17) KDM5B antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Protocols
Questions & Answers
Tech Support
Datasheet
Protocols
Questions & Answers
Tech Support
Datasheet
Protocols
Questions & Answers
Tech Support
KDM5B Polyclonal Antibody

Product Details

PA5-95382

Applications
Tested Dilution
Publications

Western Blot (WB)

0.1-0.5 µg/mL
-

Immunohistochemistry (Paraffin) (IHC (P))

0.5-1 µg/mL
-

Immunocytochemistry (ICC/IF)

2 µg/mL
-

Flow Cytometry (Flow)

1-3 µg/1x10^6 cells
-
Product Specifications

Species Reactivity

Human, Mouse, Non-human primate, Rat

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human KDM5B (641-685aa DVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFE LL).
View immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Purification

Affinity chromatography

Storage buffer

PBS with 5mg BSA, 0.9mg NaCl, 0.2mg Na2PO4

Contains

no preservative

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_2807185

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - WB: monkey COS-7 whole cell, human SH-SY5Y whole cell, rat testis tissue, mouse testis tissue. IHC: human intestinal cancer tissue, human intestinal cancer tissue, human lung cancer tissue, human breast cancer tissue, mouse testis tissue, rat testis tissue. ICC/IF: MCF-7 cell. Flow: U20S cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Target Information

KDM5B is a histone demethylase that demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. It does not demethylate histone H3 'Lys-9' or H3 'Lys-27'. KDM5B demethylates trimethylated, dimethylated and monomethylated H3 'Lys-4'. It acts as a transcriptional corepressor for FOXG1B and PAX9. It favors the proliferation of breast cancer cells by repressing tumor suppressor genes such as BRCA1 and HOXA5. In contrast, KDM5B may act as a tumor suppressor for melanoma.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: [histone H3]-trimethyl-L-lysine(4) demethylase 5B; Cancer/testis antigen 31; CT31; Histone demethylase JARID1B; jumonji, AT rich interactive domain 1B; jumonji, AT rich interactive domain 1B (Rbp2 like); Jumonji, AT rich interactive domain 1B (RBP2-like); Jumonji/ARID domain-containing protein 1B; lysine (K)-specific demethylase 5B; Lysine-specific demethylase 5B; PLU-1; protein phosphatase 1, regulatory subunit 98; putative DNA/chromatin binding motif; putative DNA/chromatin binding motif 1; RBP2-H1; Retinoblastoma-binding protein 2 homolog 1; retinoblastoma-binding protein 2, homolog 1A

View more View less

Gene Aliases: 2010009J12Rik; 2210016I17Rik; AW556288; CT31; D1Ertd202e; JARID1B; KDM5B; Kiaa4034; mKIAA4034; PLU-1; PLU1; PPP1R98; PUT1; Rb-Bp2; RBBP2H1; RBBP2H1A; RBP2-H1; RGD1565602

View more View less

UniProt ID: (Human) Q9UGL1, (Mouse) Q80Y84

View more View less

Entrez Gene ID: (Human) 10765, (Rat) 304809, (Mouse) 75605

View more View less

Function(s)
DNA binding transcription factor activity, sequence-specific DNA binding transcription corepressor activity protein binding zinc ion binding oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors histone demethylase activity histone demethylase activity (H3-K4 specific) histone demethylase activity (H3-trimethyl-K4 specific) histone demethylase activity (H3-dimethyl-K4 specific) molecular_function sulfonate dioxygenase activity oxidoreductase activity 2,4-dichlorophenoxyacetate alpha-ketoglutarate dioxygenase activity procollagen-proline dioxygenase activity hypophosphite dioxygenase activity DNA-N1-methyladenine dioxygenase activity metal ion binding dioxygenase activity C-19 gibberellin 2-beta-dioxygenase activity C-20 gibberellin 2-beta-dioxygenase activity histone modifying enzyme
Process(es)
transcription, DNA-templated single fertilization post-embryonic development positive regulation of gene expression positive regulation of mammary gland epithelial cell proliferation histone H3-K4 demethylation histone H3-K4 demethylation, trimethyl-H3-K4-specific cellular response to fibroblast growth factor stimulus negative regulation of transcription, DNA-templated rhythmic process oxidation-reduction process branching involved in mammary gland duct morphogenesis mammary duct terminal end bud growth response to fungicide uterus morphogenesis lens fiber cell differentiation regulation of estradiol secretion regulation of transcription, DNA-templated chromatin modification regulation of circadian rhythm negative regulation of nucleic acid-templated transcription
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support