Hamburger Menu Button
Thermo Fisher Scientific Logo
登入
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Tubes
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO 和 CRO 服務
    • CDMO 服務
    • 臨床試驗 CRO 服務
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • Register for an Account
    • How to Order
    • Instrument Support
    • Technical Support Centers
    • Learning Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • 快速訂購
          • 登入
            登入
            Don't have an account ? Create Account
            • 帳戶
            • 訂單
            • 訂製產品與專案
          • Primary Antibodies ›
          • KDM5B Antibodies

          Invitrogen

          KDM5B Polyclonal Antibody

          View all (17) KDM5B antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite KDM5B Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (10)
          KDM5B Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          KDM5B Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 10

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          KDM5B Antibody (PA5-95382) in ICC/IF

          Immunocytochemistry analysis of KD.M5B using anti-KD.M5B antibody (Product # PA5-95382) . KD.M5B was detected in a section of MCF-7 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 2μg/mL rabbit anti-KD.M5B antibody (Product # PA5-95382) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DA... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          KDM5B Antibody in Immunocytochemistry (ICC/IF)
          KDM5B Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          KDM5B Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          KDM5B Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          KDM5B Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          KDM5B Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          KDM5B Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          KDM5B Antibody in Western Blot (WB)
          KDM5B Antibody in Flow Cytometry (Flow)
          KDM5B Antibody in Flow Cytometry (Flow)
          KDM5B Polyclonal Antibody

          Product Details

          PA5-95382

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          2 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Non-human primate, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence in the middle region of human KDM5B (641-685aa DVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFE LL).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 5mg BSA, 0.9mg NaCl, 0.2mg Na2PO4

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807185

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: monkey COS-7 whole cell, human SH-SY5Y whole cell, rat testis tissue, mouse testis tissue. IHC: human intestinal cancer tissue, human intestinal cancer tissue, human lung cancer tissue, human breast cancer tissue, mouse testis tissue, rat testis tissue. ICC/IF: MCF-7 cell. Flow: U20S cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          KDM5B is a histone demethylase that demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. It does not demethylate histone H3 'Lys-9' or H3 'Lys-27'. KDM5B demethylates trimethylated, dimethylated and monomethylated H3 'Lys-4'. It acts as a transcriptional corepressor for FOXG1B and PAX9. It favors the proliferation of breast cancer cells by repressing tumor suppressor genes such as BRCA1 and HOXA5. In contrast, KDM5B may act as a tumor suppressor for melanoma.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: [histone H3]-trimethyl-L-lysine(4) demethylase 5B; Cancer/testis antigen 31; CT31; Histone demethylase JARID1B; HRIHFB2060; jumonji, AT rich interactive domain 1B; jumonji, AT rich interactive domain 1B (Rbp2 like); Jumonji, AT rich interactive domain 1B (RBP2-like); Jumonji/ARID domain-containing protein 1B; lysine (K)-specific demethylase 5B; Lysine-specific demethylase 5B; PLU-1; protein phosphatase 1, regulatory subunit 98; putative DNA/chromatin binding motif; putative DNA/chromatin binding motif 1; RBP2-H1; Retinoblastoma-binding protein 2 homolog 1; retinoblastoma-binding protein 2, homolog 1A; unnamed protein product

          View more View less

          Gene Aliases: 2010009J12Rik; 2210016I17Rik; AW556288; CT31; D1Ertd202e; JARID1B; KDM5B; Kiaa4034; mKIAA4034; MRT65; PLU-1; PLU1; PPP1R98; PUT1; Rb-Bp2; RBBP2H1; RBBP2H1A; RBP2-H1; RGD1565602

          View more View less

          UniProt ID: (Human) Q9UGL1, (Mouse) Q80Y84

          View more View less

          Entrez Gene ID: (Human) 10765, (Rat) 304809, (Mouse) 75605

          View more View less

          Function(s)
          nucleic acid binding DNA binding transcription corepressor activity protein binding zinc ion binding oxidoreductase activity histone demethylase activity histone demethylase activity (H3-K4 specific) histone demethylase activity (H3-trimethyl-K4 specific) histone binding metal ion binding dioxygenase activity sequence-specific double-stranded DNA binding molecular_function oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors histone demethylase activity (H3-dimethyl-K4 specific) sulfonate dioxygenase activity 2,4-dichlorophenoxyacetate alpha-ketoglutarate dioxygenase activity procollagen-proline dioxygenase activity hypophosphite dioxygenase activity DNA-N1-methyladenine dioxygenase activity C-19 gibberellin 2-beta-dioxygenase activity C-20 gibberellin 2-beta-dioxygenase activity histone modifying enzyme
          Process(es)
          chromatin organization chromatin remodeling regulation of transcription, DNA-templated single fertilization post-embryonic development positive regulation of gene expression positive regulation of mammary gland epithelial cell proliferation cellular response to fibroblast growth factor stimulus negative regulation of transcription, DNA-templated rhythmic process branching involved in mammary gland duct morphogenesis mammary duct terminal end bud growth response to fungicide uterus morphogenesis lens fiber cell differentiation cellular response to leukemia inhibitory factor regulation of estradiol secretion histone H3-K4 demethylation histone H3-K4 demethylation, trimethyl-H3-K4-specific oxidation-reduction process transcription, DNA-templated chromatin modification regulation of circadian rhythm negative regulation of nucleic acid-templated transcription
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-blue-67655d8755-zsnhf:80/100.66.75.14:80.
          git-commit: dddaa802cd395f65bf1581942d0e97a089c38f41
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.46.0-Offline