Hamburger Menu Button
Thermo Fisher Scientific Logo
Se connecter
Vous n’avez pas de compte? Créer votre compte
  • Produits
    • Anticorps
    • Oligos, amorces, sondes et gènes
    • Réactions PCR en temps réel Taqman
    • Milieux de culture cellulaire
    • Produits chimiques
    • Colonnes et cartouches de chromatographie
    • Équipement de laboratoire
    • Consommables en plastique et fournitures de laboratoire
    • Microplaques
    • Produits plus écologiques
    • Afficher toutes les catégories de produits
  • Applications
    • Bioprocédés
    • Culture cellulaire et transfection
    • Thérapie cellulaire et génétique
    • Chromatographie
    • Tests moléculaires
    • Solutions numériques
    • Extraction et analyse d’ADN et d’ARN
    • Spectroscopie, analyse élémentaire et isotopique
    • Voir toutes les applications et techniques
  • Services
    • Services CDMO et CRO à 360°
    • Services CDMO
    • Services CRO
    • Services personnalisés
    • Services financiers et leasing
    • Services pour les instruments
    • Informatique de laboratoire
    • Offres commerciales et OEM
    • Services de formation
    • Unity Lab Services
    • Voir tous les services
  • Aide et assistance
    • S’inscrire et créer un compte
    • Comment commander
    • Assistance instruments
    • Centres d’assistance technique
    • Centres d’apprentissage
    • Consultez toutes les rubriques d'aide et d'assistance
  • Populaire
    • TaqMan Real-Time PCR Assays
      Reaction PCR en temps réel TaqMan
    • Antibodies
      Anticorps
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt - Synthèse Gène
    • Cell Culture Plastics
      Plastiques culture cellulaire
  • Nos clients
    • Biotechnologie
    • Industrie biopharmaceutique
    • CDMO
    • Diagnostics de laboratoire
    • Sciences industrielles et appliquées associées
  • Promotions
  • Contactez-nous
  • Commande rapide
  • Suivi et statut de la commande
  • Documents et certificats
Thermo Fisher Scientific Logo

Search

Rechercher
Search button
          • Statut des commandes
          • Commande rapide
          • Promos
          • Se connecter
            Se connecter
            Vous n’avez pas de compte? Créer votre compte
            • Mon compte
            • Commandes
            • Connect: lab, données, apps
            • Produits personnalisés et projets
            • Services Central
          • Primary Antibodies ›
          • LCAT Antibodies

          Invitrogen

          LCAT Polyclonal Antibody

          View all (16) LCAT antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite LCAT Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (1)
          LCAT Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          LCAT Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 1

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          LCAT Antibody (PA5-95296) in WB

          Western blot analysis of LCAT in Lane 1: rat brain tissue lysate (50 µg), Lane 2: mouse testis tissue lysate (50 µg), Lane 3: HEPG2 whole cell lysate (40 µg), Lane 4: HeLa whole cell lysate (40 µg). Samples were incubated with LCAT polyclonal antibody (Product # PA5-95296). {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          LCAT Antibody in Western Blot (WB)
          LCAT Polyclonal Antibody

          Product Details

          PA5-95296

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of mouse LCAT (389-423aa QPVHLLPMNETDHLNMVFSNKTLEHINAILLGAYR).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807100

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: Rat Brain Tissue, Mouse Testis Tissue, HEPG2 whole cell, HELA whole cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          Lecithin: cholesterol acyltransferase (LCAT) is the plasma enzyme responsible for most HDL cholesteryl esters in human plasma. In species with cholesteryl ester transfer protein (CETP) it is also responsible for a significant proportion of VLDL and LDL cholesteryl esters. LCAT, through the esterification of cholesterol, plays a role in the reverse cholesterol transport pathway by facilitating the net movement of cholesterol from peripheral tissues back to the liver for excretion. LCAT deficiency results in low levels of plasma HDL, whereas a transgenic overexpression of LCAT results in increased plasma HDL concentrations.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: 1-alkyl-2-acetylglycerophosphocholine esterase; Lecithin-cholesterol acyltransferase; lecithin-cholesterol acyltransferase Lcat; lecithin-cholesterol acyltransferase precursor (EC 2.3.1.43); lecithin:cholesterol acyltransferase precursor; PAF acetylhydrolase; phosphatidylcholine--sterol O-acyltransferase; Phosphatidylcholine-sterol acyltransferase; Phospholipid-cholesterol acyltransferase; Platelet-activating factor acetylhydrolase; testicular secretory protein Li 24

          View more View less

          Gene Aliases: AI046659; D8Wsu61e; LCAT

          View more View less

          UniProt ID: (Human) P04180, (Rat) P18424, (Mouse) P16301

          View more View less

          Entrez Gene ID: (Human) 3931, (Rat) 24530, (Mouse) 16816

          View more View less

          Function(s)
          1-alkyl-2-acetylglycerophosphocholine esterase activity phosphatidylcholine-sterol O-acyltransferase activity phospholipase A2 activity sterol esterase activity protein binding O-acyltransferase activity transferase activity transferase activity, transferring acyl groups hydrolase activity apolipoprotein A-I binding platelet-activating factor acetyltransferase activity acyltransferase
          Process(es)
          lipid metabolic process phospholipid metabolic process phosphatidylcholine biosynthetic process steroid metabolic process cholesterol metabolic process cholesterol transport very-low-density lipoprotein particle remodeling high-density lipoprotein particle remodeling lipoprotein metabolic process lipoprotein biosynthetic process cholesterol homeostasis reverse cholesterol transport aflatoxin metabolic process phosphatidylcholine metabolic process response to copper ion response to glucocorticoid regulation of high-density lipoprotein particle assembly cholesterol esterification
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Commander Plus Icon Minus Icon
          • Statut des commandes
          • Assistance commandes
          • Commande rapide
          • Centre d’approvisionnement
          • Approvisionnement en ligne
          Assistance Plus Icon Minus Icon
          • Aide et assistance
          • Contactez-nous
          • Centres d’assistance technique
          • Documents et certificats
          • Signaler un problème sur le site
          Ressources Plus Icon Minus Icon
          • Centres d’apprentissage
          • Promotions
          • Événements et séminaires en ligne
          • Réseaux sociaux
          À propos de Thermo Fisher Plus Icon Minus Icon
          • À propos de nous À propos de nous
          • Emplois Emplois
          • Investisseurs Investisseurs
          • Actualités Actualités
          • Responsabilité sociale Responsabilité sociale
          • Marques commerciales
          • Politiques et notices d’information
          Notre portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          France flag icon
          France

          Your items have has been added!


          Host server : magellan-search-blue-67655d8755-b2k9d:80/100.66.79.173:80.
          git-commit: dddaa802cd395f65bf1581942d0e97a089c38f41
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.46.0-Offline