Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence at the C-terminus of mouse LCAT, different from the related human sequence by six amino acids, and from the related rat sequence by four amino acids. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Affinity chromatography |
Storage buffer |
PBS with 5mg BSA |
Contains |
0.05mg sodium azide |
Storage conditions |
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
RRID |
AB_2807100 |
Synthetic peptide sequence: 389-423aa, QPVHLLPMNETDHLNMVFSNKTLEHINAILLGAYR.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
Lecithin: cholesterol acyltransferase (LCAT) is the plasma enzyme responsible for most HDL cholesteryl esters in human plasma. In species with cholesteryl ester transfer protein (CETP) it is also responsible for a significant proportion of VLDL and LDL cholesteryl esters. LCAT, through the esterification of cholesterol, plays a role in the reverse cholesterol transport pathway by facilitating the net movement of cholesterol from peripheral tissues back to the liver for excretion. LCAT deficiency results in low levels of plasma HDL, whereas a transgenic overexpression of LCAT results in increased plasma HDL concentrations.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: 1-alkyl-2-acetylglycerophosphocholine esterase; Lecithin-cholesterol acyltransferase; lecithin-cholesterol acyltransferase Lcat; PAF acetylhydrolase; phosphatidylcholine--sterol O-acyltransferase; Phosphatidylcholine-sterol acyltransferase; Phospholipid-cholesterol acyltransferase; Platelet-activating factor acetylhydrolase; testicular secretory protein Li 24
Gene Aliases: AI046659; D8Wsu61e; LCAT
UniProt ID: (Human) P04180, (Rat) P18424, (Mouse) P16301
Entrez Gene ID: (Human) 3931, (Rat) 24530, (Mouse) 16816
Molecular Function:
acyltransferase
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support