Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
LCAT Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
PA5-95296
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of mouse LCAT (389-423aa QPVHLLPMNETDHLNMVFSNKTLEHINAILLGAYR).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2807100
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: Rat Brain Tissue, Mouse Testis Tissue, HEPG2 whole cell, HELA whole cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
Lecithin: cholesterol acyltransferase (LCAT) is the plasma enzyme responsible for most HDL cholesteryl esters in human plasma. In species with cholesteryl ester transfer protein (CETP) it is also responsible for a significant proportion of VLDL and LDL cholesteryl esters. LCAT, through the esterification of cholesterol, plays a role in the reverse cholesterol transport pathway by facilitating the net movement of cholesterol from peripheral tissues back to the liver for excretion. LCAT deficiency results in low levels of plasma HDL, whereas a transgenic overexpression of LCAT results in increased plasma HDL concentrations.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: 1-alkyl-2-acetylglycerophosphocholine esterase; Lecithin-cholesterol acyltransferase; lecithin-cholesterol acyltransferase Lcat; PAF acetylhydrolase; phosphatidylcholine--sterol O-acyltransferase; Phosphatidylcholine-sterol acyltransferase; Phospholipid-cholesterol acyltransferase; Platelet-activating factor acetylhydrolase; testicular secretory protein Li 24
Gene Aliases: AI046659; D8Wsu61e; LCAT
UniProt ID: (Human) P04180, (Rat) P18424, (Mouse) P16301
Entrez Gene ID: (Human) 3931, (Rat) 24530, (Mouse) 16816
phospholipid metabolic process
phosphatidylcholine biosynthetic process
cholesterol metabolic process
cholesterol transport
very-low-density lipoprotein particle remodeling
high-density lipoprotein particle remodeling
cholesterol esterification
lipoprotein metabolic process
lipoprotein biosynthetic process
cholesterol homeostasis
reverse cholesterol transport
phosphatidylcholine metabolic process
response to copper ion
response to glucocorticoid
regulation of high-density lipoprotein particle assembly
lipid metabolic process
steroid metabolic process
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support