Hamburger Menu Button
Thermo Fisher Scientific Logo
Iniciar sesión
¿No tiene una cuenta? Crear una cuenta
  • Productos
    • Consumibles de laboratorio
    • Equipos de laboratorio
    • Instrumentos de Laboratorio
    • Clínica y Diagnóstico
    • Cromatografía
    • Espectrometría de Masas
    • Cultivo Celular
    • Análisis Celular
    • Anticuerpos
    • Veja todas as categorias de produtos
  • Aplicaciones
    • Cultivo celular y transfección
    • Citometría de flujo
    • Investigación sobre el cáncer
    • Cromatografía
    • Secuenciación
    • PCR
    • Soluciones para laboratorio
    • Diagnóstico de alergias
    • Ver todas las aplicaciones y técnicas
  • Servicios
    • Servicios Personalizados
    • Servicios de Capacitación
    • Informática para laboratorios de ámbito empresarial
    • Servicios financieros y de arrendamiento
    • Servicios 360° de CDMO y CRO
    • Servicios de CDMO
    • Servicios de CRO
    • Inspección de seguridad alimentaria Servicios
    • Ver todos los servicios
  • Ayuda y Soporte
    • Crear una nueva cuenta
    • Cómo hacer el pedido
    • Póngase en contacto con nosotros
    • Cambio de ubicación
    • Ver toda la ayuda y soporte técnico
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • A quiénes brindamos nuestros servicios
    • Industria biotecnológica
    • Sector biofarmacéutico
    • CDMO
    • Diagnósticos de laboratorio
    • Ciencias aplicadas e industriales
  • Ofertas especiales
  • Contáctenos
  • Orden Rápida
  • Documentos y certificados
Thermo Fisher Scientific Logo

Search

Buscar
Search button
          • Contáctenos
          • Orden Rápida
          • Iniciar sesión
            Iniciar sesión
            ¿No tiene una cuenta? Crear una cuenta
            • Cuenta
            • Pedidos
            • Productos y proyectos personalizados
          • Primary Antibodies ›
          • LCK Antibodies

          Invitrogen

          LCK Polyclonal Antibody

          Advanced Verification
          1 Reference
          View all (48) LCK antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite LCK Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (10)
          • Advanced Verification (2)
          LCK Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          LCK Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 12

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          LCK Antibody (PA5-79587) in ICC/IF

          Immunocytochemistry analysis of Lck using anti-Lck antibody (Product # PA5-79587). Lck was detected in a section of U2OS cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 2μg/mL rabbit anti-Lck antibody (Product # PA5-79587) overnight at 4°C. DyLight®594 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize ... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          LCK Antibody in Immunocytochemistry (ICC/IF)
          LCK Antibody in Immunocytochemistry (ICC/IF)
          LCK Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          LCK Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          LCK Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          LCK Antibody in Immunohistochemistry (Frozen) (IHC (F))
          LCK Antibody in Western Blot (WB)
          LCK Antibody in Western Blot (WB)
          LCK Antibody in Western Blot (WB)
          LCK Antibody in Flow Cytometry (Flow)
          LCK Antibody
          LCK Antibody
          LCK Polyclonal Antibody

          Product Details

          PA5-79587

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          Immunohistochemistry (Frozen) (IHC (F))

          0.5-1 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          2 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -

          Immunoprecipitation (IP)

          -
          View 1 publication 1 publication
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Published species

          Mouse

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human Lck (468-506aa ELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQ).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746702

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human Jurkat whole cell, mouse spleen tissue, mouse thymus tissue. IHC: mouse lymphaden tissue, rat lymphaden tissue, human tonsil tissue IHC-F: mouse spleen tissue. ICC/IF: U20S cell. Flow: HepG2 cell.

          Target Information

          LCK is a member of the Src-family tyrosine kinase, which are essential for signaling through the T-cell receptor (TCR) complex. Upon TCR triggering, LCK phosphorylates the ITAM motives in its zeta subunits establishing binding sites for the SH2 domains of the tyrosine kinase ZAP70, which is also phosphorylated by LCK and activated to generate subsequent signaling platforms by phosphorylation of adaptor LAT. The majority of LCK is localized to the plasma membrane, however, there is also a significant fraction associated with the Golgi apparatus which may contribute to Raf activation under conditions of weak stimulation through the TCR. LCK contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. LCK is also involved in the regulation of apoptosis induced by various stimuli, but not by the death receptors. Diseases associated with LCK include Immunodeficiency 22 and CD45 deficiency. Alternatively splice variants of the LCK gene encoding different isoforms of the protein have been found.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          Bioinformatics

          Protein Aliases: EC 2.7.10.2; kinase Lck; Leukocyte C-terminal Src kinase; LSK; Lymphocyte cell-specific protein-tyrosine kinase; lymphocyte protein tyrosine kinase; lymphocyte-specific protein tyrosine kinase; OTTHUMP00000008640; OTTHUMP00000008740; OTTHUMP00000008741; p56(LSTRA) protein-tyrosine kinase; p56-LCK; Protein YT16; Proto-oncogene Lck; Proto-oncogene tyrosine-protein kinase LCK; RP4-675E8.4; T cell-specific protein-tyrosine kinase; T-lymphocyte specific protein tyrosine kinase p56lck; tyr; Tyrosine-protein kinase Lck; unnamed protein product

          View more View less

          Gene Aliases: Hck-3; IMD22; LCK; Lck1; Lcktkr; LSK; Lsk-t; Lskt; p56; p56Lck; pp58lck; YT16

          View more View less

          UniProt ID: (Human) P06239, (Rat) Q01621, (Mouse) P06240

          View more View less

          Entrez Gene ID: (Human) 3932, (Rat) 313050, (Mouse) 16818

          View more View less

          Function(s)
          nucleotide binding phosphotyrosine binding protein kinase activity protein tyrosine kinase activity non-membrane spanning protein tyrosine kinase activity protein serine/threonine phosphatase activity receptor binding protein binding ATP binding phospholipase activator activity kinase activity transferase activity protein kinase binding protein phosphatase binding SH2 domain binding T cell receptor binding CD4 receptor binding CD8 receptor binding identical protein binding phospholipase binding phosphatidylinositol 3-kinase binding ATPase binding protein antigen binding glycoprotein binding antigen binding protein C-terminus binding protein complex binding transferase activity, transferring phosphorus-containing groups
          Process(es)
          protein phosphorylation cellular zinc ion homeostasis apoptotic process activation of cysteine-type endopeptidase activity involved in apoptotic process cell surface receptor signaling pathway transmembrane receptor protein tyrosine kinase signaling pathway aging response to mechanical stimulus response to metal ion response to zinc ion positive regulation of gene expression dephosphorylation peptidyl-tyrosine phosphorylation T cell differentiation peptidyl-tyrosine autophosphorylation regulation of cell proliferation response to drug positive regulation of tyrosine phosphorylation of Stat5 protein response to hydrogen peroxide regulation of apoptotic process innate immune response positive regulation of gamma-delta T cell differentiation protein autophosphorylation B cell receptor signaling pathway regulation of T cell receptor signaling pathway positive regulation of T cell receptor signaling pathway positive regulation of T cell activation release of sequestered calcium ion into cytosol positive regulation of uterine smooth muscle contraction cellular response to peptide hormone stimulus positive regulation of intrinsic apoptotic signaling pathway phosphorylation immune response-activating cell surface receptor signaling pathway response to xenobiotic stimulus hemopoiesis platelet activation T cell costimulation positive regulation of heterotypic cell-cell adhesion intracellular signal transduction Fc-gamma receptor signaling pathway T cell activation gamma-delta T cell differentiation positive regulation of MAPK cascade regulation of regulatory T cell differentiation T cell receptor signaling pathway leukocyte migration positive regulation of multicellular organismal process regulation of lymphocyte activation CD27 signaling pathway positive regulation of leukocyte cell-cell adhesion
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Pedidos Plus Icon Minus Icon
          • Estatus del pedido
          • Ayuda para pedidos
          • Orden Rápida
          • Supply Center
          • eProcurement
          Soporte Plus Icon Minus Icon
          • Ayuda y soporte
          • Entre en Contacto
          • Centros de asistencia técnica
          • Consultar documentos y certificados
          • Informar de un problema en la web
          Recursos Plus Icon Minus Icon
          • Centros de aprendizaje
          • Promociones
          • Eventos & Webinars
          • Medios Sociales
          Acerca de Thermo Fisher Plus Icon Minus Icon
          • Acerca de nosotros Acerca de nosotros
          • Empleo Empleo
          • Inversores Inversores
          • Noticias Noticias
          • Responsabilidad social Responsabilidad social
          • Marcas comerciales
          • Políticas y avisos
          Nuestro Portafolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Argentina flag icon
          Argentina

          Your items have has been added!


          Host server : magellan-search-blue-744bc48644-454p7:80/100.66.72.101:80.
          git-commit: 747bde55a712f6f97bf7760408d445eefba4e16f
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.48.0-Offline