Search

  • お問い合わせ一覧​
  • クイックオーダー

Invitrogen

LCK Polyclonal Antibody

Advanced Verification
1 Reference
View all (45) LCK antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Additional Information:
{{banner.description}}
{{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
LCK Polyclonal Antibody

Product Details

PA5-79587

Applications
Tested Dilution
Publications

Western Blot (WB)

0.1-0.5 µg/mL
-

Immunohistochemistry (Paraffin) (IHC (P))

0.5-1 µg/mL
-

Immunohistochemistry (Frozen) (IHC (F))

0.5-1 µg/mL
-

Immunocytochemistry (ICC/IF)

2 µg/mL
-

Flow Cytometry (Flow)

1-3 µg/1x10^6 cells
-

Immunoprecipitation (IP)

-
View 1 publication 1 publication
Product Specifications

Species Reactivity

Human, Mouse, Rat

Published species

Mouse

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human Lck (468-506aa ELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQ).
3D Epitope / Immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Amount

100 µg

Purification

Antigen affinity chromatography

Storage buffer

PBS with 4mg trehalose

Contains

no preservative

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_2746702

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - WB: human Jurkat whole cell, mouse spleen tissue, mouse thymus tissue. IHC: mouse lymphaden tissue, rat lymphaden tissue, human tonsil tissue IHC-F: mouse spleen tissue. ICC/IF: U20S cell. Flow: HepG2 cell.

Target Information

LCK is a member of the Src-family tyrosine kinase, which are essential for signaling through the T-cell receptor (TCR) complex. Upon TCR triggering, LCK phosphorylates the ITAM motives in its zeta subunits establishing binding sites for the SH2 domains of the tyrosine kinase ZAP70, which is also phosphorylated by LCK and activated to generate subsequent signaling platforms by phosphorylation of adaptor LAT. The majority of LCK is localized to the plasma membrane, however, there is also a significant fraction associated with the Golgi apparatus which may contribute to Raf activation under conditions of weak stimulation through the TCR. LCK contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. LCK is also involved in the regulation of apoptosis induced by various stimuli, but not by the death receptors. Diseases associated with LCK include Immunodeficiency 22 and CD45 deficiency. Alternatively splice variants of the LCK gene encoding different isoforms of the protein have been found.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Bioinformatics

Protein Aliases: EC 2.7.10.2; kinase Lck; Leukocyte C-terminal Src kinase; LSK; Lymphocyte cell-specific protein-tyrosine kinase; lymphocyte protein tyrosine kinase; lymphocyte-specific protein tyrosine kinase; OTTHUMP00000008640; OTTHUMP00000008740; OTTHUMP00000008741; p56(LSTRA) protein-tyrosine kinase; p56-LCK; Protein YT16; Proto-oncogene Lck; Proto-oncogene tyrosine-protein kinase LCK; RP4-675E8.4; T cell-specific protein-tyrosine kinase; T-lymphocyte specific protein tyrosine kinase p56lck; tyr; Tyrosine-protein kinase Lck; unnamed protein product

View more View less

Gene Aliases: Hck-3; IMD22; LCK; Lck1; Lcktkr; LSK; Lsk-t; Lskt; p56; p56Lck; pp58lck; YT16

View more View less

UniProt ID: (Human) P06239, (Rat) Q01621, (Mouse) P06240

View more View less

Entrez Gene ID: (Human) 3932, (Rat) 313050, (Mouse) 16818

View more View less

Function(s)
nucleotide binding phosphotyrosine binding protein kinase activity protein tyrosine kinase activity non-membrane spanning protein tyrosine kinase activity protein serine/threonine phosphatase activity receptor binding protein binding ATP binding phospholipase activator activity kinase activity transferase activity protein kinase binding protein phosphatase binding SH2 domain binding T cell receptor binding CD4 receptor binding CD8 receptor binding identical protein binding phospholipase binding phosphatidylinositol 3-kinase binding ATPase binding protein antigen binding glycoprotein binding antigen binding protein C-terminus binding protein complex binding transferase activity, transferring phosphorus-containing groups
Process(es)
protein phosphorylation cellular zinc ion homeostasis apoptotic process activation of cysteine-type endopeptidase activity involved in apoptotic process cell surface receptor signaling pathway transmembrane receptor protein tyrosine kinase signaling pathway aging response to mechanical stimulus response to metal ion response to zinc ion positive regulation of gene expression dephosphorylation peptidyl-tyrosine phosphorylation T cell differentiation peptidyl-tyrosine autophosphorylation regulation of cell proliferation response to drug positive regulation of tyrosine phosphorylation of Stat5 protein response to hydrogen peroxide regulation of apoptotic process innate immune response positive regulation of gamma-delta T cell differentiation protein autophosphorylation B cell receptor signaling pathway regulation of T cell receptor signaling pathway positive regulation of T cell receptor signaling pathway positive regulation of T cell activation release of sequestered calcium ion into cytosol positive regulation of uterine smooth muscle contraction cellular response to peptide hormone stimulus positive regulation of intrinsic apoptotic signaling pathway phosphorylation immune response-activating cell surface receptor signaling pathway response to xenobiotic stimulus hemopoiesis platelet activation T cell costimulation positive regulation of heterotypic cell-cell adhesion intracellular signal transduction Fc-gamma receptor signaling pathway T cell activation gamma-delta T cell differentiation positive regulation of MAPK cascade regulation of regulatory T cell differentiation T cell receptor signaling pathway leukocyte migration positive regulation of multicellular organismal process regulation of lymphocyte activation CD27 signaling pathway positive regulation of leukocyte cell-cell adhesion
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support