Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
| Applications | Tested Dilution | Publications |
|---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
| Product Specifications | |
|---|---|
Species Reactivity |
Human, Mouse |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence at the C-terminus of human LIM kinase 2, different from the related mouse sequence by four amino acids, and from the related rat sequence by three amino acids. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Affinity chromatography |
Storage buffer |
PBS with 5mg BSA |
Contains |
0.05mg sodium azide |
Storage conditions |
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
RRID |
AB_2807108 |
Synthetic peptide sequence: 596-635aa, KLEDSFEALSLYLGELGIPLPAELEELDHTVSMQYGLTRD.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. The protein encoded by this gene is phosphorylated and activated by ROCK, a downstream effector of Rho, and the encoded protein, in turn, phosphorylates cofilin, inhibiting its actin-depolymerizing activity. It is thought that this pathway contributes to Rho-induced reorganization of the actin cytoskeleton. At least three transcript variants encoding different isoforms have been found for this gene.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: EC 2.7.11.1; kinase LIMK2; LIM domain kinase 2; LIM kinase 2; LIMK; LIMK 2; LIMK-2; LIMK1; LINhp-2; OTTHUMP00000199483
Gene Aliases: Limk-2; LIMK2
UniProt ID: (Human) P53671, (Mouse) Q9QUL4
Entrez Gene ID: (Human) 3985, (Mouse) 16886
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support
