Search
Invitrogen
LOXL2 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 1
LOXL2 Antibody (PA5-95306) in WB
Western blot analysis of LOXL2 in, Lane 1: human Hela whole cell lysates, Lane 2: human MCF-7 whole cell lysates, Lane 3: human MDA-MB-453 whole cell lysates, Lane 4: rat brain tissue lysates, Lane 5: mouse brain tissue lysates, Lane 6: mouse lung tissue lysates. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 µg of sample under reducing conditions. After Electrophoresis, proteins were transferred to a nitrocellulose membrane at... View More
Product Details
PA5-95306
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human LOXL2 (739-770aa HRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQ).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human Hela whole cell, human MCF-7 whole cell, human MDA-MB-453 whole cell, rat brain tissue, mouse brain tissue, mouse lung tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: LOXL2 DELTA e13; Lysyl oxidase homolog 2; lysyl oxidase related 2; lysyl oxidase-like 2 delta e13; lysyl oxidase-like 2 protein; Lysyl oxidase-like protein 2; Lysyl oxidase-related protein 2; Lysyl oxidase-related protein WS9-14; unnamed protein product
Gene Aliases: 1110004B06Rik; 4930526G11Rik; 9430067E15Rik; LOR; LOR2; LOXL2; WS9-14
UniProt ID: (Human) Q9Y4K0, (Mouse) P58022, (Rat) B5DF27
Entrez Gene ID: (Human) 4017, (Mouse) 94352, (Rat) 290350
protein-lysine 6-oxidase activity
copper ion binding
calcium ion binding
protein binding
oxidoreductase activity
oxidoreductase activity, acting on the CH-NH2 group of donors, oxygen as acceptor
metal ion binding
oligosaccharide binding
chromatin binding
transcription corepressor activity
scavenger receptor activity
methylated histone binding
oxidase
negative regulation of transcription from RNA polymerase II promoter
response to hypoxia
epithelial to mesenchymal transition
endothelial cell proliferation
sprouting angiogenesis
chromatin organization
positive regulation of epithelial to mesenchymal transition
peptidyl-lysine oxidation
collagen fibril organization
positive regulation of chondrocyte differentiation
protein modification process
endothelial cell migration
negative regulation of transcription, DNA-templated
response to copper ion
heterochromatin organization
negative regulation of stem cell population maintenance
transcription, DNA-templated
regulation of transcription, DNA-templated
cellular protein modification process
chromatin modification
histone modification
protein deamination
oxidation-reduction process
receptor-mediated endocytosis
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support