Synthetic peptide sequence: 470-501aa, DELYDIMKMCWKEKAEERPTFDYLQSVLDDFY.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
Lyn proto oncogene (Lcl/Yes related novel protein tyrosine kinase) is encoded by the Lyn gene located on chromosome 8 in humans and belongs to the Src family kinase. It is a non-receptor tyrosine kinase that acts as a mediator in transducing cellular signaling. The most well studied expression of Lyn is in hematopoietic cell types, both lymphoid and myeloid cells with exclusion in T lymphocytes. It has also been observed that Lyn plays diverse roles such as in regulation of B cell receptor signaling, mast cell signaling and Epithelial - Mesenchymal Transition (EMT).
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: FLJ26625; Lck/Yes-related novel protein tyrosine kinase; lyn protein non-receptor kinase; p53Lyn; p56Lyn; Tyrosine-protein kinase Lyn; V-yes-1 Yamaguchi sarcoma viral related oncogene homolog; Yamaguchi sarcoma viral (v-yes-1) oncogene homolog
Gene Aliases: AA407514; Hck-2; JTK8; LYN; p53Lyn; p56Lyn
UniProt ID: (Human) P07948, (Mouse) P25911, (Rat) Q07014
Entrez Gene ID: (Human) 4067, (Mouse) 17096, (Rat) 81515
Molecular Function:
kinase
non-receptor tyrosine protein kinase
protein kinase
transferase
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support