Search
Invitrogen
SUR2A Monoclonal Antibody (N319A/14)
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 4
SUR2A Antibody (MA5-27637) in ICC/IF
Immunofluorescent analysis of SUR2A in human neuroblastoma cell line (SK-N-BE). Sample was fixed with 4% formaldehyde (15 min at RT), incubated with SUR2A monoclonal antibody (Product # MA5-27637) using a dilution of 1:100 (1 hour at RT), and followed by Goat Anti-Mouse 488, Phalloidin Texas Red and DAPI secondary antibody at a dilution of 1:100, 1:1000 (60 min at RT) and 1:5000 (5 min at RT). Images are shown as follows: (A) DAPI (blue) nuclear stain, B) Phalloidin Texas Red F-Actin stain, C) SUR2A Antibody, D) Merged image. Magnification... View More
Product Details
MA5-27637
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Mouse
/ IgG2a
Class
Monoclonal
Type
Antibody
Clone
N319A/14
Immunogen
Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A
Conjugate
Form
Liquid
Concentration
1 mg/mL
Amount
100 µg
Purification
Protein G
Storage buffer
PBS, pH 7.4, with 50% glycerol
Contains
0.1% sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
1 µg/mL of MA5-27637 was sufficient for detection of SUR2A in 20 µg of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.|Detects approximately 120kDa. Does not cross-react with SUR2B.
This antibody was formerly sold as clone S319A-14.
Target Information
Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the energy balance within the cell.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Bioinformatics
Protein Aliases: ATP-binding cassette sub-family C member 9; ATP-binding cassette transporter sub-family C member 9; ATP-binding cassette, sub-family C (CFTR/MRP), member 9; FLJ36852; Sulfonylurea receptor 2; sulfonylurea-binding protein 2; unnamed protein product
Gene Aliases: ABC37; ABCC9; AI414027; AI449286; ATFB12; CANTU; CMD1O; IDMYS; SUR2; SUR2A; SUR2B
UniProt ID: (Human) O60706, (Rat) Q63563, (Mouse) P70170
Entrez Gene ID: (Human) 10060, (Rat) 25560, (Mouse) 20928
nucleotide binding
potassium channel activity
ATP binding
sulfonylurea receptor activity
ATP-activated inward rectifier potassium channel activity
potassium channel regulator activity
ATPase activity
cation-transporting ATPase activity
transmembrane transporter activity
ATPase activity, coupled to transmembrane movement of substances
anion transmembrane-transporting ATPase activity
ion channel binding
macromolecular complex binding
potassium channel activator activity
ABC-type transporter activity
drug binding
syntaxin binding
identical protein binding
ATP-binding cassette (ABC) transporter
MAPK cascade
action potential
blood vessel development
response to hypoxia
heart morphogenesis
vascular process in circulatory system
regulation of transcription from RNA polymerase II promoter
potassium ion transport
response to stress
mitochondrion organization
heart development
skeletal muscle tissue development
blood circulation
regulation of blood pressure
response to xenobiotic stimulus
gene expression
response to activity
fatty acid oxidation
response to ATP
response to potassium ion
cellular response to potassium ion
response to decreased oxygen levels
vasodilation
regulation of membrane potential
response to hydrogen peroxide
negative regulation of apoptotic process
response to estrogen
cellular respiration
negative regulation of blood pressure
ATP metabolic process
fibroblast proliferation
defense response to virus
transmembrane transport
coronary vasculature development
cardiac conduction
cellular response to chemical stress
response to oxygen levels
cellular response to calcium ion
cellular response to ATP
cellular response to xenobiotic stimulus
potassium ion transmembrane transport
circulatory system development
oxygen metabolic process
cardiac muscle cell contraction
regulation of blood vessel diameter
cation transmembrane transport
anion transmembrane transport
inorganic cation transmembrane transport
transport across blood-brain barrier
regulation of potassium ion transmembrane transport
response to peptide
reactive oxygen species biosynthetic process
response to hydrogen sulfide
potassium ion import across plasma membrane
substrate-dependent cell migration, cell contraction
signal transduction
metabolic process
potassium ion import
response to drug
transport
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support