Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Cell Analysis
    • Antibodies
    • Mass Spectrometry
    • Cell Culture
    • Laboratory Instruments
    • Clinical and Diagnostics
    • Chromatography
    • Laboratory Equipment
    • Laboratory Supplies
    • Molecular Biology and Nucleic Acid Analysis
    • Sequence-Specific Nucleic Acid Products
    • See all product categories
  • Applications
    • Cell Culture and Transfection
    • Flow Cytometry
    • Cancer Research
    • Chromatography
    • Sequencing
    • PCR
    • Lab Solutions
    • Allergy Diagnostics
    • See all applications and techniques
  • Services
    • Cell Biology Services
    • Custom Services
    • Training Services
    • Lab Informatics Services
    • Financial and Leasing Services
    • Partnering and Licensing Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Food Safety Inspection Services
    • See all services
  • Help and Support
    • How to Order
    • Promotions and Online Offers
    • Contact Us
    • Change Location
    • Create a New Account
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Special Offers
  • Contact Us
  • Quick Order
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Contact Us
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Custom Products & Projects
          • Primary Antibodies ›
          • Ataxin 1 Antibodies

          Invitrogen

          Ataxin 1 Monoclonal Antibody (N76/8)

          View all (39) Ataxin 1 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite Ataxin 1 Monoclonal Antibody (N76/8)

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (2)
          Ataxin 1 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          Ataxin 1 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 2

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          Ataxin 1 Antibody (MA5-27666) in ICC/IF

          Immunofluorescent analysis of Ataxin 1 in human neuroblastoma cell line (SK-N-BE). Sample was fixed with 4% formaldehyde (15 min at RT), incubated with Ataxin 1 monoclonal antibody (Product # MA5-27666) using a dilution of 1:100 (1 hour at RT), and followed by Goat Anti-Mouse 488, Phalloidin Texas Red and DAPI secondary antibody at a dilution of 1:200, 1:1000 (60 min at RT) and 1:5000 (5 min at RT). Images are shown as follows: (A) DAPI (blue) nuclear stain, B) Phalloidin Texas Red F-Actin stain, C) Ataxin 1 Antibody, D) Merged image. Magn... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          Ataxin 1 Antibody in Immunocytochemistry (ICC/IF)
          Ataxin 1 Antibody in Western Blot (WB)
          Ataxin 1 Monoclonal Antibody (N76/8)

          Product Details

          MA5-27666

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          1:1,000
          -

          Immunohistochemistry (PFA fixed) (IHC (PFA))

          1:100
          -

          Immunocytochemistry (ICC/IF)

          1:100
          -

          Immunoprecipitation (IP)

          Assay-Dependent
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Mouse / IgG2b

          Class

          Monoclonal

          Type

          Antibody

          Clone

          N76/8

          Immunogen

          Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated
          • APC 
          • FITC
          • PE 
          • PerCP 
          • Request custom conjugation

          Form

          Liquid

          Concentration

          1 mg/mL

          Amount

          100 µg

          Purification

          Protein G

          Storage buffer

          PBS, pH 7.4, with 50% glycerol

          Contains

          0.1% sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2735120

          Product Specific Information

          1 µg/mL of MA5-27666 was sufficient for detection of Ataxin-1 in 20 µg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.|Detects approximately 85kDa.

          This antibody was formerly sold as clone S76-8.

          Target Information

          The autosomal dominant cerebellar ataxias (ADCA) are a heterogeneous group of neurodegenerative disorders characterized by progressive degeneration of the cerebellum, brain stem and spinal cord. Clinically, ADCA has been divided into three groups: ADCA types I-III. ADCAI is genetically heterogeneous, with five genetic loci, designated spinocerebellar ataxia (SCA) 1, 2, 3, 4 and 6, being assigned to five different chromosomes. ADCAII, which always presents with retinal degeneration (SCA7), and ADCAIII often referred to as the `pure' cerebellar syndrome (SCA5), are most likely homogeneous disorders. Several SCA genes have been cloned and shown to contain CAG repeats in their coding regions. ADCA is caused by the expansion of the CAG repeats, producing an elongated polyglutamine tract in the corresponding protein. The expanded repeats are variable in size and unstable, usually increasing in size when transmitted to successive generations. The function of the ataxins is not known. This locus has been mapped to chromosome 6, and it has been determined that the diseased allele contains 41-81 CAG repeats, compared to 6-39 in the normal allele, and is associated with spinocerebellar ataxia type 1 (SCA1). At least two transcript variants encoding the same protein have been found for this gene.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: Alt-ATXN1; alternative ataxin1; Ataxin-1; OTTHUMP00000016065; spinocerebellar ataxia 1; spinocerebellar ataxia 1 homolog; Spinocerebellar ataxia type 1 protein; Spinocerebellar ataxia type 1 protein homolog

          View more View less

          Gene Aliases: 2900016G23Rik; ATX1; ATXN1; C85907; D6S504E; ENSMUSG00000074917; Gm10786; SCA1

          View more View less

          UniProt ID: (Human) P54253, (Mouse) P54254, (Rat) Q63540

          View more View less

          Entrez Gene ID: (Human) 6310, (Mouse) 20238, (Rat) 25049

          View more View less

          Function(s)
          DNA binding chromatin binding RNA binding protein binding poly(U) RNA binding POZ domain binding poly(G) binding identical protein binding protein C-terminus binding protein self-association molecular_function
          Process(es)
          negative regulation of transcription from RNA polymerase II promoter transcription, DNA-templated regulation of transcription, DNA-templated adult locomotory behavior visual learning negative regulation of phosphorylation negative regulation of insulin-like growth factor receptor signaling pathway negative regulation of transcription, DNA-templated positive regulation of transcription from RNA polymerase II promoter lung alveolus development nuclear export excitatory postsynaptic potential positive regulation of glial cell proliferation biological_process transcription from RNA polymerase II promoter RNA processing brain development learning memory social behavior insulin-like growth factor receptor signaling pathway
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          • Social Media
          • Contact Us
          • Report a Site Issue
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Responsibility Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Chile flag icon
          Chile

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-8dsbr:80/100.66.76.150:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline