Search
Invitrogen
alpha Actinin 3 Monoclonal Antibody (9B5)
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 2
alpha Actinin 3 Antibody (MA5-33007) in IHC (P)
Immunohistochemistry analysis of alpha Actinin 3 in paraffin-embedded human skeletal muscle tissue. Antigen retrieval was performed on the tissue using citrate buffer (pH 6, 20 min) and blocked with 10% goat serum. Samples were incubated with alpha Actinin 3 monoclonal antibody (Product # MA5-33007) at a 1 µg/mL dilution, followed by biotinylated goat anti-mouse IgG, and developed with Strepavidin-Biotin-Co... View More
Product Details
MA5-33007
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Mouse
/ IgG1
Class
Monoclonal
Type
Antibody
Clone
9B5
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574-617aa EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINT K).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: rat skeletal muscle tissue, mouse skeletal muscle tissue. IHC: human skeletal muscle tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Actinin alpha3; Actinin-alpha3; alpha-actinin skeletal muscle; Alpha-actinin skeletal muscle isoform 3; Alpha-actinin-3; alpha-Actinin3; alphaActinin-3; F-actin cross-linking protein; unnamed protein product
Gene Aliases: ACTN3; ACTN3D
UniProt ID: (Human) Q08043, (Mouse) O88990
Entrez Gene ID: (Human) 89, (Mouse) 11474, (Rat) 171009
regulation of the force of skeletal muscle contraction
skeletal muscle atrophy
transition between fast and slow fiber
response to denervation involved in regulation of muscle adaptation
actin cytoskeleton organization
positive regulation of fast-twitch skeletal muscle fiber contraction
regulation of apoptotic process
negative regulation of glycolytic process
focal adhesion assembly
positive regulation of skeletal muscle tissue growth
positive regulation of skeletal muscle fiber development
muscle cell development
bone morphogenesis
negative regulation of calcineurin-NFAT signaling cascade
regulation of muscle system process
negative regulation of oxidative phosphorylation
negative regulation of cold-induced thermogenesis
positive regulation of bone mineralization involved in bone maturation
negative regulation of relaxation of muscle
regulation of aerobic respiration
positive regulation of glucose catabolic process to lactate via pyruvate
muscle contraction
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support