Search

  • Contáctenos
  • Orden Rápida

Invitrogen

YY1 Monoclonal Antibody (2C10F9)

View all (36) YY1 antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Additional Information:
{{banner.description}}
{{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
YY1 Monoclonal Antibody (2C10F9)

Product Details

MA5-49173

Applications
Tested Dilution
Publications

Western Blot (WB)

0.25-0.5 µg/mL
-

Immunohistochemistry (Paraffin) (IHC (P))

2-5 µg/mL
-

Flow Cytometry (Flow)

1-3 µg/1x10^6 cells
-
Product Specifications

Species Reactivity

Human, Mouse, Rat

Host/Isotype

Mouse / IgG2a

Class

Monoclonal

Type

Antibody

Clone

2C10F9

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human YY1 (206-241aa EQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQ).
3D Epitope / Immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Amount

100 µg

Purification

Antigen affinity chromatography

Storage buffer

PBS with 4mg trehalose

Contains

no preservative

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_3074831

Product Specific Information

Adding 0.2 mL of distilled water will yield a concentration of 500 µg/mL.

Immunogen sequence is identical to the related mouse sequence.

Positive Control - WB: human Caco-2 whole cell, human SW620 whole cell, human MDA-MB-453, human PC-3 whole cell, rat thymus tissue, mouse thymus tissue. IHC: human thyroid cancer tissue, human pancreatic ductal adenocarcinoma tissue, human laryngeal squamous cell carcinomas tissue, human renal clear cell carcinoma tissue. Flow: PC-3 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Target Information

YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: Delta transcription factor; INO80 complex subunit S; NF-E1; Transcriptional repressor protein YY1; UCR-motif DNA-binding protein; UCRBP transcription factor; Yin and yang 1; Yin and Yang 1 protein; Yin Yang 1; YY-1

View more View less

Gene Aliases: AW488674; DELTA; GADEVS; INO80S; NF-E1; NMP-1; NMP1; UCRBP; YIN-YANG-1; YY1

View more View less

UniProt ID: (Human) P25490, (Mouse) Q00899

View more View less

Entrez Gene ID: (Human) 7528, (Rat) 24919, (Mouse) 22632

View more View less

Function(s)
four-way junction DNA binding transcription regulatory region sequence-specific DNA binding RNA polymerase II core promoter proximal region sequence-specific DNA binding RNA polymerase II transcription factor activity, sequence-specific DNA binding core promoter proximal region sequence-specific DNA binding bacterial-type RNA polymerase transcriptional repressor activity, sequence-specific DNA binding transcriptional repressor activity, RNA polymerase II transcription regulatory region sequence-specific binding transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding DNA binding chromatin binding transcription factor activity, sequence-specific DNA binding RNA binding protein binding zinc ion binding sequence-specific DNA binding SMAD binding metal ion binding DNA-binding transcription factor binding sequence-specific double-stranded DNA binding transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding enhancer sequence-specific DNA binding histone deacetylase binding transcription regulatory region DNA binding nucleic acid binding C2H2 zinc finger transcription factor
Process(es)
negative regulation of transcription from RNA polymerase II promoter telomere maintenance double-strand break repair via homologous recombination regulation of DNA replication DNA repair regulation of DNA repair DNA recombination chromatin remodeling regulation of transcription, DNA-templated regulation of transcription from RNA polymerase II promoter RNA localization cellular response to DNA damage stimulus spermatogenesis anterior/posterior pattern specification response to UV-C gene expression positive regulation of gene expression negative regulation of gene expression hemopoiesis cell differentiation B cell differentiation negative regulation of interferon-beta production regulation of chromosome organization cellular response to UV response to prostaglandin F positive regulation of DNA repair positive regulation of transcription, DNA-templated positive regulation of transcription from RNA polymerase II promoter regulation of embryonic development camera-type eye morphogenesis chromosome organization regulation of cell cycle regulation of DNA strand elongation negative regulation of cell growth involved in cardiac muscle cell development cellular response to interleukin-1 immunoglobulin heavy chain V-D-J recombination negative regulation of pri-miRNA transcription from RNA polymerase II promoter positive regulation of telomere maintenance in response to DNA damage transcription from RNA polymerase II promoter transcription, DNA-templated
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support