Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Immunohistochemistry (Paraffin) (IHC (P)) |
0.5-1 µg/mL | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence of human MEF2C. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Affinity chromatography |
Storage buffer |
PBS with 4mg trehalose |
Contains |
0.05mg sodium azide |
Storage conditions |
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
RRID |
AB_2807370 |
Synthetic peptide sequence: DREDHRNE FHSPIGLTRPSPDERESPSVKRMRLSEGWAT.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
MEF2C is a transcription activator which binds specifically to the MEF2 element present in the regulatory regions of many muscle-specific genes. Controls cardiac morphogenesis and myogenesis, and is also involved in vascular development. Plays an essential role in hippocampal-dependent learning and memory by suppressing the number of excitatory synapses and thus regulating basal and evoked synaptic transmission. Crucial for normal neuronal development, distribution, and electrical activity in the neocortex. Necessary for proper development of megakaryocytes and platelets and for bone marrow B lymphopoiesis. Required for B-cell survival and proliferation in response to BCR stimulation, efficient IgG1 antibody responses to T-cell-dependent antigens and for normal induction of germinal center B cells. May also be involved in neurogenesis and in the development of cortical architecture. Isoform 3 and isoform 4, which lack the repressor domain, are more active than isoform 1 and isoform 2.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: MADS box transcription enhancer factor 2, polypeptide C; Myocyte enhancer factor 2C; Myocyte-specific enhancer factor 2C
Gene Aliases: 5430401D19Rik; 9930028G15Rik; AV011172; C5DELq14.3; DEL5q14.3; Mef2; MEF2C; RGD1563119
UniProt ID: (Human) Q06413, (Rat) A0A096MJY4, (Mouse) Q8CFN5
Entrez Gene ID: (Human) 4208, (Rat) 499497, (Mouse) 17260
Molecular Function:
MADS box transcription factor
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support