Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
MMP9 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
PA5-79689
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Mouse,
Rat
Published species
C. elegans
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP-9 (641-672aa KALLFSKGRVWRFDLKSQKVDPQSVIRVDKEF).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: NRK whole cell, ANA-1 whole cell, HEPA whole cell. IHC: mouse kidney tissue, rat liver tissue.
Target Information
MMP9 (matrix metallopeptidase 9, GELB, CLG4B) is a matrix metalloproteinase, a family of zinc and calcium-dependent endopeptidases that degrade extracellular matrix proteins. MMP9 is secreted as a 92kDa zymogen and cleavage of pro-MMP9 results in the active enzyme with a molecular weight of 82kDa. MMP9 has a gelatin-binding domain consisting of three fibronectin type II units, a catalytic domain containing the zinc-binding site, a proline-rich type V collagen-homologous domain and a hemopexin-like domain. MMP9 is produced by monocytes, macrophages, neutrophils, keratinocytes, fibroblasts, osteoclasts and endothelial cells, and is involved in inflammatory responses, tissue remodeling, wound healing, tumor growth and metastasis. MMP9 is supplied by bone marrow-derived cells and contributes to skin carcinogenesis. Further, MMP9 degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling. Studies have shown that elevated MMP9 is associated with progression of idiopathic atrial fibrillation and aortic aneurysm.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Bioinformatics
Protein Aliases: 92 kDa gelatinase; 92 kDa type IV collagenase; 92-kDa type IV collagenase; 92kD gelatinase; 92kD type IV collagenase; 92kDa gelatinase; 92kDa type IV collagenase; collagenase type IVB; Gel B; Gelatinase B; Gelatinase-B; GELB; matrix metallo protease; matrix metalloproteinase 9; matrix metalloproteinase 9 (gelatinase B 92-kDa type IV collagenase); matrix metalloproteinase 9 (gelatinase B, 92-kDa type IV collagenase); Matrix metalloproteinase-9; Matrix metalloproteinase9; MMP; MMP-9; MMPs
Gene Aliases: AW743869; B/MMP9; Clg4b; MMP-9; Mmp9; pro-MMP-9
UniProt ID: (Rat) P50282, (Mouse) P41245
Entrez Gene ID: (Rat) 81687, (Mouse) 17395
skeletal system development
ossification
response to hypoxia
kidney development
positive regulation of leukocyte migration
proteolysis
response to oxidative stress
embryo implantation
parturition
aging
response to nutrient
response to radiation
response to heat
response to mechanical stimulus
response to high light intensity
response to organic substance
response to organic cyclic compound
transformation of host cell by virus
extracellular matrix organization
collagen catabolic process
positive regulation of synaptic plasticity
response to estradiol
response to lipopolysaccharide
response to retinoic acid
response to vitamin A
response to tumor necrosis factor
response to nicotine
endodermal cell differentiation
response to drug
positive regulation of apoptotic process
response to ethanol
positive regulation of angiogenesis
negative regulation of fibroblast proliferation
tissue remodeling
leukocyte migration
protein oligomerization
positive regulation of keratinocyte migration
response to hyperoxia
cellular response to lipopolysaccharide
cellular response to iron(III) ion
cellular response to cytokine stimulus
cellular response to interleukin-1
cellular response to tumor necrosis factor
cellular response to low-density lipoprotein particle stimulus
cellular response to cell-matrix adhesion
positive regulation of receptor binding
negative regulation of cation channel activity
positive regulation of protein phosphorylation
negative regulation of apoptotic process
positive regulation of DNA binding
positive regulation of epidermal growth factor receptor signaling pathway
positive regulation of release of cytochrome c from mitochondria
negative regulation of intrinsic apoptotic signaling pathway
negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support