The synthetic peptide sequence is 409-450aa, TEALQQLQKDSEAIRSQYAHYFDLSLVNNGVDETLKKLQEAF
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
This gene encodes the prototype of the membrane-associated guanylate kinase (MAGUK) family proteins. MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intercellular junctions. The encoded protein is an extensively palmitoylated membrane phosphoprotein containing a PDZ domain, a Src homology 3 (SH3) motif, and a guanylate kinase domain. This gene product interacts with various cytoskeletal proteins and cell junctional proteins in different tissue and cell types, and may be involved in the regulation of cell shape, hair cell development, neural patterning of the retina, and apico-basal polarity and tumor suppression pathways in non-erythroid cells. Multiple transcript variants encoding different isoforms have been found for this gene.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: 55 kDa erythrocyte membrane protein; aging-associated gene 12; erythrocyte membrane protein p55; Membrane protein, palmitoylated 1; membrane protein, palmitoylated 1, 55kDa; migration-related gene 1; p55; palmitoylated erythrocyte membrane protein
Gene Aliases: 55kDa; AAG12; C130070C03Rik; DXS552E; EMP55; MPP1; MRG1; p55; PEMP
UniProt ID: (Human) Q00013, (Mouse) P70290
Entrez Gene ID: (Rat) 652956, (Human) 4354, (Mouse) 17524
Molecular Function:
cell junction protein
kinase
nucleotide kinase
protein kinase
transferase
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support