Search Thermo Fisher Scientific
Search Thermo Fisher Scientific
Applications | Tested Dilution | Publications |
---|---|---|
Immunohistochemistry (IHC) |
- | View 1 publication 1 publication |
Immunohistochemistry (Paraffin) (IHC (P)) |
2-5 µg/mL | - |
Immunohistochemistry (PFA fixed) (IHC (PFA)) |
- | View 1 publication 1 publication |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Published species |
Human |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence of human MUC2 (DDFKTASGLVEATGAGFANTWKAQSTCHDKLDWLDD). |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Antigen affinity chromatography |
Storage buffer |
PBS with 4mg trehalose |
Contains |
0.05mg sodium azide |
Storage conditions |
-20°C |
RRID |
AB_2746817 |
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Secreted epithelial mucins are large macromolecules which exhibit extreme polydispersity. Mucin 2 is the major intestinal mucin. O-glycans are attached to MUC2 in a potentially diverse arrangement, which is crucial for their interaction with endogeneous and exogeneous lectins.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: colonic mucin; intestinal mucin-2; MCM; MUC-2; muc2; mucin 2, intestinal/tracheal; mucin-2; mucin-like protein; secreted gel-forming mucin
Gene Aliases: 2010015E03Rik; HH-Muc; MCM; MLP; MUC-2; SMUC; wnn
Entrez Gene ID: (Human) 4583, (Rat) 24572, (Mouse) 17831
Molecular Function:
extracellular matrix protein
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support