Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
| Applications | Tested Dilution | Publications |
|---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Immunohistochemistry (Paraffin) (IHC (P)) |
0.5-1 µg/mL | - |
| Product Specifications | |
|---|---|
Species Reactivity |
Human, Mouse |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence at the N-terminus of human NARG1, different from the related mouse sequence by one amino acid. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Affinity chromatography |
Storage buffer |
PBS with 4mg trehalose |
Contains |
0.05mg sodium azide |
Storage conditions |
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
RRID |
AB_2807224 |
Synthetic peptide sequence: 244-287aa, ADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKY.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
This gene encodes a protein of unknown function. However, similarity to proteins in yeast and other species suggests that this protein may be an N-acetyltransferase.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: Gastric cancer antigen Ga19; N-alpha-acetyltransferase 15, NatA auxiliary subunit; N-terminal acetyltransferase; N-terminal acetyltransferase 1; N-terminal aceyltransferase 1; NMDA receptor regulated 1; NMDA receptor-regulated gene 1; NMDA receptor-regulated protein 1; Protein tubedown-1; Tbdn100; transcriptional coactivator tubedown-100; tubedown; tubedown-1
Gene Aliases: 5730450D16Rik; 6330400I15; ASTBDN; GA19; mNAT1; NAA15; NARG1; NAT1P; NATH; TBDN; Tbdn-1; TBDN100
UniProt ID: (Human) Q9BXJ9
Entrez Gene ID: (Human) 80155, (Mouse) 74838
Molecular Function:
acetyltransferase
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support
