Hamburger Menu Button
Thermo Fisher Scientific Logo
登入
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Tubes
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO 和 CRO 服務
    • CDMO 服務
    • 臨床試驗 CRO 服務
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • Register for an Account
    • How to Order
    • Instrument Support
    • Technical Support Centers
    • Learning Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • 快速訂購
          • 登入
            登入
            Don't have an account ? Create Account
            • 帳戶
            • 訂單
            • 訂製產品與專案
          • Primary Antibodies ›
          • NME1 Antibodies

          Invitrogen

          NME1 Polyclonal Antibody

          View all (39) NME1 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite NME1 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (3)
          NME1 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          NME1 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 3

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          NME1 Antibody (PA5-79743) in WB

          Western blot analysis of NME1 using NME1 Polyclonal Antibody (Product # PA5-79743). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 µg of sample under reducing conditions. Lane 1: rat brain tissue lysates. Lane 2: rat liver tissue lysates. Lane 3: rat lung tissue lysates. Lane 4: rat C6 whole cell lysates. Lane 5: mouse brain tissue lysates. Lane 6: mouse liver tissue lysates. Lane 7: mouse lung tissue lysates. Lane 8: mouse NIH/3... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          NME1 Antibody in Western Blot (WB)
          NME1 Antibody in Western Blot (WB)
          NME1 Antibody in Flow Cytometry (Flow)
          NME1 Polyclonal Antibody

          Product Details

          PA5-79743

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of human NM23A (26-58aa KRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDR).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746858

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human Hela whole cell, human A431 whole cell, human HepG2 whole cell, human K562 whole cell, human MCF-7 whole cell, human A375 whole cell, human MOLT-4 whole cell, rat brain tissue, rat liver tissue, rat lung tissue, rat C6 whole cell, mouse brain tissue, mouse liver tissue, mouse lung tissue, mouse NIH/3T3 whole cell. Flow: HEL cell.

          Target Information

          NME1 was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in the gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: epididymis secretory sperm binding protein; expressed in non-metastatic cells 1 protein; expressed in non-metastatic cells 1 protein (NM23A) (nucleoside diphosphate kinase); expressed in non-metastatic cells 1, protein; expressed in non-metastatic cells 1, protein (NM23A) (nucleoside diphosphate kinase); Farnesyl diphosphate kinase NME1; GAAD; Granzyme A activated DNase (GAAD); granzyme A-activated DNase; GZMA activated DNase; Histidine protein kinase NDK; Histidine protein kinase NME1; included; Metastasis inhibition factor NM23; NDK A; NDK1; NDP kinase A; NDP kinase beta; NDPK-A; NM23-H1; nm23-M1; NM23H1; NM23H1B; NME1; NME1-NME2 spliced read-through transcript; non-metastatic cells 1, protein (NM23A) expressed in; Non-specific serine/threonine protein kinase NME1; Nucleoside diphoshate kinase 1; Nucleoside diphosphate kinase A; nucleoside-diphosphate kinase 1; nucleotide diphosphate kinase; nucloside diphosphate kinase; Putative 3'-5'-DNA exonuclease NDK1; Putative granzyme A-activated DNA endonuclease; Tumor metastatic process-associated protein; unnamed protein product

          View more View less

          Gene Aliases: AL024257; AWD; GAAD; NB; NBS; NDKA; NDPK-A; NDPKA; NM23; NM23-H1; NM23-M1; NM23A; NME1

          View more View less

          UniProt ID: (Human) P15531, (Mouse) P15532, (Rat) Q05982

          View more View less

          Entrez Gene ID: (Human) 4830, (Mouse) 18102, (Rat) 191575

          View more View less

          Function(s)
          nucleotide binding magnesium ion binding DNA binding RNA binding endodeoxyribonuclease activity deoxyribonuclease activity nucleoside diphosphate kinase activity protein histidine kinase activity protein binding ATP binding 3'-5'-exodeoxyribonuclease activity kinase activity transferase activity phosphotransferase activity, phosphate group as acceptor GDP binding identical protein binding ribosomal small subunit binding ADP binding metal ion binding farnesyl diphosphate kinase activity coenzyme A binding succinyl-CoA binding acetyl-CoA binding RNA polymerase II regulatory region sequence-specific DNA binding single-stranded DNA binding GTP binding intermediate filament binding enzyme binding protein kinase binding gamma-tubulin binding poly(A) RNA binding kinase
          Process(es)
          GTP biosynthetic process UTP biosynthetic process CTP biosynthetic process DNA catabolic process apoptotic DNA fragmentation isoprenoid metabolic process endocytosis nervous system development lactation negative regulation of cell proliferation nucleotide metabolic process nucleoside diphosphate metabolic process nucleoside triphosphate biosynthetic process cell differentiation mammary gland development protein hexamerization regulation of fatty acid biosynthetic process regulation of apoptotic process ITP biosynthetic process acetyl-CoA catabolic process positive regulation of epithelial cell proliferation negative regulation of myeloid leukocyte differentiation purine nucleotide metabolic process nucleoside diphosphate phosphorylation pyrimidine nucleotide metabolic process DNA metabolic process negative regulation of gene expression positive regulation of neuron projection development phosphorylation positive regulation of DNA binding nucleic acid phosphodiester bond hydrolysis integrin-mediated signaling pathway response to amine hippocampus development response to testosterone cellular response to drug response to drug negative regulation of apoptotic process positive regulation of keratinocyte differentiation positive regulation of transcription from RNA polymerase II promoter response to cAMP cellular response to glucose stimulus cellular response to fatty acid
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-n9r8p:80/100.66.76.150:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline