Synthetic peptide sequence: 1797-1827aa, LKNASDGALMDDNQNEWGDEDLETKKFRFEE.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
The notch gene belongs to a family of epidermal growth factor (EGF) like homeotic genes, which encode transmembrane proteins with a variable number of cysteine-rich EGF-like repeats in the extracellular region. Four notch genes have been described in mammals: Notch1, Notch2, Notch3 and Notch4(Int-3), which have been implicated in the differentiation of the nervous system and other structures. The EGF-like proteins Delta and Serrate have been identified as ligands of Notch1. Mature Notch proteins are heterodimeric receptors derived from the cleavage of Notch pre-proteins into an extracellular subunit (NEC) containing multiple EGF-like repeats and a transmembrane subunit including intracellular region (Ntm).
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: major type A protein; Motch A; mT14; Neurogenic locus notch homolog protein 1; NEXT; NICD; Notch 1; Notch 1 extracellular truncation; Notch 1 intracellular domain; Notch gene homolog 1; Notch homolog 1, translocation-associated; p300; RP23-306D20.12; RP23-306D20.12-001; Translocation-associated notch protein TAN-1; transmembrane receptor Notch1
Gene Aliases: 9930111A19Rik; AOS5; AOVD1; hN1; lin-12; Mis6; Motch; N1; NOTCH1; TAN1
UniProt ID: (Human) P46531, (Mouse) Q01705
Entrez Gene ID: (Human) 4851, (Mouse) 18128
Molecular Function:
defense/immunity protein
membrane-bound signaling molecule
receptor
signaling molecule
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support