Search
Invitrogen
NPY Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
PA5-95226
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Neuropeptide Y (29-64aa YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - IHC: Mouse Brain Tissue, Rat Brain Tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase, regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Neuropeptide-Y; OTTHUMP00000201947; prepro-neuropeptide Y; Pro-neuropeptide Y; pro-neuropeptide Y-like; unnamed protein product
Gene Aliases: 0710005A05Rik; NPY; NPY02; PYY4; RATNPY; RATNPY02
UniProt ID: (Human) P01303, (Mouse) P57774, (Rat) P07808
Entrez Gene ID: (Rat) 100912228, (Human) 4852, (Mouse) 109648, (Rat) 24604
neuropeptide signaling pathway
cell-cell signaling
feeding behavior
regulation of appetite
response to yeast
negative regulation of acute inflammatory response to antigenic stimulus
G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
chemical synaptic transmission
regulation of blood pressure
positive regulation of cell proliferation
adult feeding behavior
positive regulation of cell-substrate adhesion
antibacterial humoral response
antifungal humoral response
central nervous system neuron development
cerebral cortex development
neuron projection development
positive regulation of appetite
regulation of nerve growth factor production
monocyte activation
innate immune response
negative regulation of blood pressure
positive regulation of dopamine metabolic process
short-day photoperiodism
defense response to Gram-negative bacterium
defense response to Gram-positive bacterium
intestinal epithelial cell differentiation
antimicrobial humoral immune response mediated by antimicrobial peptide
positive regulation of ERK1 and ERK2 cascade
regulation of presynaptic cytosolic calcium ion concentration
synaptic signaling via neuropeptide
positive regulation of eating behavior
positive regulation of nitric oxide metabolic process
regulation of synaptic vesicle exocytosis
sensory perception of taste
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support