Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
NSE Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 9
NSE Antibody (PA5-95555) in ICC/IF
Immunocytochemistry analysis of NSE using anti-NSE antibody (Product # PA5-95555) . NSE was detected in a section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 5μg/mL rabbit anti-NSE antibody (Product # PA5-95555) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize... View More
Product Details
PA5-95555
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human NSE (LKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGTENK).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human 22RV1 whole cell, human U20S whole cell, human A431 whole cell, human HepG2 whole cell, human A549 whole cell, human SHG-44 whole cell, rat brain tissue, mouse brain tissue. IHC: human lung cancer tissue, human placenta tissue, human pancreatic cancer tissue, rat brain tissue, mouse brain tissue. ICC/IF: A431 cell. Flow: A431 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
Neuron specific enolase (NSE, ENO1, ENO2, ENO3) is an enzyme that catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate in the glycolytic pathway, and the reverse reaction in gluconeogenesis. NSE has a high stability in biological fluids and can easily diffuse to the extracellular medium and cerebrospinal fluid (CSF) when neuronal membranes are injured.NSE is one of three mammalian enolases, which are also known as ENO1, ENO2, and ENO3 or alternately as enolase alpha, beta and gamma. The alpha-subunit is expressed in most tissues, the beta-subunit only in muscle, and the gamma-subunit is expressed primarily in neurons, in normal and in neoplastic neuroendocrine cells. Co-expression of NSE and chromogranin A is common in neuroendocrine neoplasms. Since neurons require a great deal of energy, they are very rich in glycolytic enzymes such a GAPDH and NSE. Antibodies to NSE protein are useful to identify neuronal cell bodies, developing neuronal lineage and neuroendocrine cells. Release of NSE from damaged neurons into CSF and blood has also been used as a biomarker of neuronal injury. NSE is used clinically as a sensitive and useful marker of neuronal damage in several neurological disorders including stroke, hypoxic brain damage, status epilepticus, Creutzfeldt-Jakob disease, and herpetic encephalitis. Further, NSE is found in elevated concentrations in plasma and certain neoplasias that include pediatric neuroblastoma and small cell lung cancer.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: 2-phospho-D-glycerate hydro-lyase; 2-phospho-D-glycerate hydrolyase; Eno; ENOG; Enolase 2; enolase 2 (gamma, neuronal); epididymis secretory protein Li 279; gamma enolase; Gamma-enolase; Neural enolase; neuron specific enolase; neuron specific gamma enolase; Neuron-specific enolase; Neuronal Enolase; neuronal enriched enolase; neurone-specific enolase; NSE
Gene Aliases: AI837106; D6Ertd375e; Eno-2; ENO2; HEL-S-279; NSE; RNEN3
UniProt ID: (Human) P09104, (Mouse) P17183, (Rat) P07323
Entrez Gene ID: (Human) 2026, (Mouse) 13807, (Rat) 24334
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support