Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 1
OGG1 Antibody (PA5-95494) in WB
Western blot analysis of OGG1 in Lane 1: rat spleen tissue lysate, Lane 2: rat thymus tissue lysate, Lane 3: rat liver tissue lysate, Lane 4: rat testis tissue lysate. Electrophoresis was performed with 5-20% SDS-PAGE gel (70V, Stacking gel; 90V Resolving gel, Time: 2-3 hours), transferred to a nitrocellulose membrane and blocked using 5% Non-fat Milk/TBS (1.5 hrs at room temperature). Samples were incubated with OGG1 polyclonal antibody (Product # PA5-95494) using a 0.5 µg/mL dilution, followed by a goat anti-rabbit IgG-HRP at a dilution ... View More
Product Details
PA5-95494
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human Ogg1 (KYFQLDVTLAQLYHHWGSVDSHFQEVAQKFQGVRLLRQD).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2807296
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: rat spleen tissue, rat thymus tissue, rat liver tissue, rat testis tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
8-hydroxyguanine, a form of oxidative DNA damage induced by free radicals, causes G:C to T:A transversion. In E. Coli, three DNA repair enzymes exist to prevent the mutagenic effects of 8-hydroxyguanine. One of these enzymes, MutM, was found to have a functional yeast (yOgg1) and human (hOgg1) homologue. hOgg1 proteins efficiently released the 8-hydroxyguanine opposite the pyrimidine from DNA and cleaved the AP site in a manner similar to bacterial and yeast enzymes. Genetic backgrounds in control of the repair of damaged DNA are involved in the susceptibility to cancer development. The hOgg1 gene has been mapped to region 3p26. 2, a region showing loss of heterozygosity (LOH) in a variety of cancers. In particular, 3p25-p26 is a common LOH region in lung cancer.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: 8-hydroxyguanine DNA glycosylase; 8-oxoguanine DNA-glycosylase 1; 8-oxoguanine-DNA-glycosylase; AP lyase; DNA-apurinic or apyrimidinic site lyase; N-glycosylase/DNA lyase; OGG1 type 1f
Gene Aliases: HMMH; HOGG1; MMH; MUTM; OGG1; OGH1
UniProt ID: (Human) O15527, (Mouse) O08760, (Rat) O70249
Entrez Gene ID: (Human) 4968, (Mouse) 18294, (Rat) 81528
damaged DNA binding
endonuclease activity
protein binding
microtubule binding
oxidized purine nucleobase lesion DNA N-glycosylase activity
oxidized purine DNA binding
8-oxo-7,8-dihydroguanine DNA N-glycosylase activity
purine-specific mismatch base pair DNA N-glycosylase activity
oxidized base lesion DNA N-glycosylase activity
DNA binding
catalytic activity
DNA-(apurinic or apyrimidinic site) lyase activity
uracil DNA N-glycosylase activity
hydrolase activity
hydrolase activity, acting on glycosyl bonds
lyase activity
single-strand selective uracil DNA N-glycosylase activity
DNA N-glycosylase activity
DNA-3-methylbase glycosylase activity
nicotinamide riboside hydrolase activity
nicotinic acid riboside hydrolase activity
deoxyribonucleoside 5'-monophosphate N-glycosidase activity
DNA metabolism protein
acute inflammatory response
base-excision repair
regulation of transcription, DNA-templated
cellular response to DNA damage stimulus
response to oxidative stress
aging
response to radiation
response to light stimulus
response to estradiol
regulation of protein import into nucleus, translocation
nucleotide-excision repair, DNA incision
response to drug
negative regulation of apoptotic process
depurination
depyrimidination
response to ethanol
response to folic acid
cellular response to cadmium ion
negative regulation of double-strand break repair via single-strand annealing
DNA repair
nucleotide-excision repair
metabolic process
nucleic acid phosphodiester bond hydrolysis
DNA catabolic process, endonucleolytic
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support