Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Pipettes and Pipette Tips
    • Lab Centrifuges
    • Ultra-Low Temperature Freezers
    • Spectroscopy
    • Beakers
    • PCR Equipment and Supplies
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • See all product categories
  • Applications
    • Cell Analysis
    • Lab Equipment
    • Real-Time PCR
    • PCR
    • Chromatography
    • Cell Culture and Transfection
    • DNA and RNA Extraction and Analysis
    • Protein Biology
    • Flow Cytometry
    • Chemicals
    • See all applications and techniques
  • Services
    • Custom Services
    • Lab Informatics
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Instrument Services
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • Customer Center
    • Contact Us
    • Certificates of Analysis and Conformance
    • Safety Data Sheets (SDS)
    • Manuals
    • How to Cite Our Products in a Paper
    • Instrument Support
    • Knowledge Base and Product FAQs
    • Learning Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Custom Products & Projects
            • Services Central
          • Primary Antibodies ›
          • OGT Antibodies

          Invitrogen

          OGT Polyclonal Antibody

          View all (19) OGT antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite OGT Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (9)
          OGT Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          OGT Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 9

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          OGT Antibody (PA5-95319) in ICC/IF

          Immunocytochemistry analysis of OGT using anti-OGT antibody (Product # PA5-95319) . OGT was detected in a section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 2μg/mL rabbit anti-OGT antibody (Product # PA5-95319) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          OGT Antibody in Immunocytochemistry (ICC/IF)
          OGT Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          OGT Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          OGT Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          OGT Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          OGT Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          OGT Antibody in Western Blot (WB)
          OGT Antibody in Flow Cytometry (Flow)
          OGT Antibody in Flow Cytometry (Flow)
          OGT Polyclonal Antibody

          Product Details

          PA5-95319

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          2 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human OGT (1008-1046aa NTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807122

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human Hela whole cell, human PC-3 whole cell, human A431 whole cell, human A549 whole cell, human Caco-2 whole cell, human K562 whole cell, rat heart tissue, mouse heart tissue. IHC: mouse intestine tissue, rat intestine tissue, human gastric cancer tissue, human pancreatic cancer tissue, rat pancreas tissue. ICC/IF: A431 cell. Flow: U937 cell, RAW2647 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          This gene encodes a glycosyltransferase that catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains multiple tetratricopeptide repeats that are required for optimal recognition of substrates. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: FLJ23071; MGC22921; O linked N-acetylglucosamine transferase; o-glcnac transferase; O-GlcNAc transferase p110 subunit; O-GlcNAc transferase subunit p110; O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase); O-linked N-acetylglucosamine transferase 110 kDa subunit; OGT; UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit; UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase; unnamed protein product; uridinediphospho-N-acetylglucosamine:polypeptide beta-N-acetylglucosaminyl transferase

          View more View less

          Gene Aliases: 1110038P24Rik; 4831420N21Rik; AI115525; HINCUT-1; HRNT1; MRX106; O-GLCNAC; OGT; OGT1; Ogtl; XLID106

          View more View less

          UniProt ID: (Human) O15294, (Mouse) Q8CGY8, (Rat) P56558

          View more View less

          Entrez Gene ID: (Human) 8473, (Mouse) 108155, (Rat) 26295

          View more View less

          Function(s)
          protein binding phosphatidylinositol-3,4,5-trisphosphate binding lipid binding acetylglucosaminyltransferase activity transferase activity transferase activity, transferring glycosyl groups chromatin DNA binding protein O-GlcNAc transferase activity catalytic activity enzyme activator activity N-acetyltransferase activity transcription factor binding protein N-acetylglucosaminyltransferase activity protein domain specific binding peptide binding histone acetyltransferase activity (H4-K5 specific) histone acetyltransferase activity (H4-K8 specific) histone acetyltransferase activity (H4-K16 specific) monosaccharide binding protein modifying enzyme
          Process(es)
          negative regulation of transcription from RNA polymerase II promoter mitophagy positive regulation of transcription from RNA polymerase II promoter by glucose cytoplasmic translation regulation of glycolytic process regulation of gluconeogenesis chromatin organization regulation of transcription from RNA polymerase II promoter protein glycosylation protein O-linked glycosylation apoptotic process signal transduction response to nutrient protein processing negative regulation of translation hemopoiesis negative regulation of cell migration negative regulation of transforming growth factor beta receptor signaling pathway negative regulation of protein ubiquitination cellular response to nutrient levels negative regulation of proteasomal ubiquitin-dependent protein catabolic process response to insulin circadian regulation of gene expression regulation of Rac protein signal transduction TORC1 signaling positive regulation of translation positive regulation of proteolysis positive regulation of transcription, DNA-templated positive regulation of transcription from RNA polymerase II promoter negative regulation of translational initiation positive regulation of translational initiation regulation of insulin receptor signaling pathway positive regulation of lipid biosynthetic process rhythmic process protein maturation regulation of synapse assembly regulation of necroptotic process protein localization to lysosome pyroptosis cellular response to glucose stimulus regulation of neurotransmitter receptor localization to postsynaptic specialization membrane positive regulation of cold-induced thermogenesis membraneless organelle assembly non-canonical inflammasome complex assembly negative regulation of non-canonical inflammasome complex assembly negative regulation of stem cell population maintenance positive regulation of stem cell population maintenance positive regulation of TORC1 signaling negative regulation of protein phosphorylation positive regulation of protein phosphorylation glucosamine metabolic process positive regulation of gene expression negative regulation of peptidyl-threonine phosphorylation chromatin modification positive regulation of granulocyte differentiation negative regulation of peptidyl-serine phosphorylation positive regulation of catalytic activity histone H4-K5 acetylation histone H4-K8 acetylation histone H4-K16 acetylation positive regulation of cell size phosphatidylinositol-mediated signaling intracellular distribution of mitochondria positive regulation of histone H3-K4 methylation negative regulation of cell death positive regulation of histone H3-K27 methylation protein homotrimerization protein heterotrimerization cellular response to lipopolysaccharide cellular response to retinoic acid histone H3-K4 trimethylation negative regulation of protein targeting to membrane regulation of gluconeogenesis involved in cellular glucose homeostasis negative regulation of cellular response to hypoxia positive regulation of protein localization to nucleus positive regulation of reactive oxygen species biosynthetic process forebrain development cellular response to insulin stimulus cellular response to toxic substance
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Fair Trade Fair Trade
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Korea flag icon
          Korea

          Customer Help Desk | working day 09:00~18:00
          1661-9555   |   Live Chat   |   카카오톡 상담

           

          Service Call Center | working day 09:00~18:00
          1661-5055   |   Live Chat

          Customer Help Desk | working day 09:00~18:00
          1661-9555   |   Live Chat   |   카카오톡 상담

           

          Service Call Center | working day 09:00~18:00
          1661-5055   |   Live Chat

          Customer Help Desk | working day 09:00~18:00
          1661-9555   |   Live Chat   |   카카오톡 상담

           

          Service Call Center | working day 09:00~18:00
          1661-5055   |   Live Chat

          Thermo Fisher Scientific Korea Ltd.
          Representative : Soojin Seok
          Company Registration No. : 117-81-46910

           

          Thermo Fisher Scientific Solutions LLC
          Representative : Soojin Seok
          Company Registration No. : 114-86-04783

           

          Location: 12F Suseo Office Building, 281 Gwangpyeong-ro, Gangnam-gu, Seoul, Korea(06349) | Mail-Order Business Registration : 2015-Seoul Gangnam-00898 | Payment : ShinHan Bank 140-004-396660 (Thermo Fisher Scientific Solutions LLC)

          ISMS Logo

          Your items have has been added!


          Host server : magellan-search-blue-67655d8755-x75fr:80/100.66.77.4:80.
          git-commit: dddaa802cd395f65bf1581942d0e97a089c38f41
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.46.0-Offline