Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Immunohistochemistry (Paraffin) (IHC (P)) |
0.5-1 µg/mL | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence at the C-terminus of human OGT, identical to the related mouse and rat sequences. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Affinity chromatography |
Storage buffer |
PBS with 5mg BSA |
Contains |
0.05mg sodium azide |
Storage conditions |
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
RRID |
AB_2807122 |
Synthetic peptide sequence: 1008-1046aa, NTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
This gene encodes a glycosyltransferase that catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains multiple tetratricopeptide repeats that are required for optimal recognition of substrates. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: FLJ23071; MGC22921; O linked N-acetylglucosamine transferase; o-glcnac transferase; O-GlcNAc transferase p110 subunit; O-GlcNAc transferase subunit p110; O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase); O-linked N-acetylglucosamine transferase 110 kDa subunit; OGT; UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit; UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase; uridinediphospho-N-acetylglucosamine:polypeptide beta-N-acetylglucosaminyl transferase
Gene Aliases: 1110038P24Rik; 4831420N21Rik; AI115525; HINCUT-1; HRNT1; O-GLCNAC; OGT; Ogtl
UniProt ID: (Human) O15294, (Mouse) Q91Y38, (Rat) P56558
Entrez Gene ID: (Human) 8473, (Mouse) 108155, (Rat) 26295
Molecular Function:
protein modifying enzyme
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support