Search
Invitrogen
Cyclin T1 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 11
Cyclin T1 Antibody (PA5-78944) in ICC/IF
Immunocytochemistry analysis of Cyclin T1 using anti-Cyclin T1 antibody (Product # PA5-78944) . Cyclin T1 was detected in a section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 2μg/mL rabbit anti-Cyclin T1 antibody (Product # PA5-78944) overnight at 4°C. DyLight®488 Conjugated ... View More
Product Details
PA5-78944
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Cyclin T1 (375-410aa QKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENM).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: rat kidney tissue, mouse spleen tissue, JURKAT whole cell. IHC: mouse intestine tissue, rat intestine tissue, human intestinal cancer tissue. ICC/IF: A431 cell. Flow: U20S cell, U937 cell.
Target Information
This gene encodes a member of the highly conserved cyclin C subfamily. The encoded protein tightly associates with cyclin-dependent kinase 9, and is a major subunit of positive transcription elongation factor b (p-TEFb). In humans, there are multiple forms of positive transcription elongation factor b, which may include one of several different cyclins along with cyclin-dependent kinase 9. The complex containing the encoded cyclin and cyclin-dependent kinase 9 acts as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and is both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner are also involved in triggering transcript elongation through phosphorylation of the carboxy-terminal domain of the largest RNA polymerase II subunit. Overexpression of this gene is implicated in tumor growth. Alternative splicing results in multiple transcript variants.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: CDK9-associated C-type protein; cyclin C-related protein; cyclin T1b; cyclin-T; Cyclin-T1; CycT1; human immunodeficiency virus type 1 (HIV-1) expression (elevated) 1; MLLT10/CCNT1 fusion; unnamed protein product
Gene Aliases: 2810478G24Rik; AI115585; CCNT; CCNT1; CYCT1; HIVE1
UniProt ID: (Human) O60563, (Mouse) Q9QWV9
Entrez Gene ID: (Human) 904, (Rat) 315291, (Mouse) 12455
transcription regulatory region sequence-specific DNA binding
DNA binding
chromatin binding
protein binding
cyclin-dependent protein serine/threonine kinase regulator activity
snRNA binding
protein kinase binding
cyclin-dependent protein serine/threonine kinase activator activity
RNA polymerase binding
7SK snRNA binding
DNA-binding transcription factor binding
molecular condensate scaffold activity
molecular_function
transcription regulatory region DNA binding
kinase activator
regulation of cyclin-dependent protein serine/threonine kinase activity
regulation of transcription from RNA polymerase II promoter
transcription from RNA polymerase II promoter
response to xenobiotic stimulus
positive regulation of DNA-templated transcription, elongation
positive regulation of transcription elongation from RNA polymerase II promoter
positive regulation by host of viral transcription
positive regulation of transcription from RNA polymerase II promoter
cell division
transcription, DNA-templated
regulation of transcription, DNA-templated
protein phosphorylation
biological_process
response to drug
negative regulation of mRNA polyadenylation
cell cycle
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support